Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164NB51

Protein Details
Accession A0A164NB51    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
160-184PDGGERFRRHRARSPLRNRSTPRHPBasic
NLS Segment(s)
PositionSequence
167-174RRHRARSP
Subcellular Location(s) nucl 8, mito 8, mito_nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MFVSMADAFSKTCSLFVQHSCQLGFRTPLRTALRQGGKLITCARSDRTVYGTLAETPTNLLLPSFSVESIILHHAAIRLRIGPSDPTIDCFREARYHLIKHLIASEGPSASLLPLALNLIRPLPNFSALNGMTITKQYRAVLRQTPAVETTFGIPQSLSPDGGERFRRHRARSPLRNRSTPRHPAGVLLSIGWSDSRLLPMPGDPIYLSSSPGALDSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.23
4 0.29
5 0.31
6 0.34
7 0.34
8 0.34
9 0.33
10 0.31
11 0.32
12 0.28
13 0.29
14 0.28
15 0.36
16 0.39
17 0.4
18 0.41
19 0.45
20 0.48
21 0.45
22 0.46
23 0.43
24 0.38
25 0.38
26 0.38
27 0.32
28 0.28
29 0.28
30 0.29
31 0.28
32 0.29
33 0.27
34 0.27
35 0.27
36 0.25
37 0.24
38 0.22
39 0.2
40 0.19
41 0.17
42 0.14
43 0.12
44 0.12
45 0.1
46 0.09
47 0.07
48 0.06
49 0.06
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.09
57 0.1
58 0.09
59 0.08
60 0.09
61 0.1
62 0.11
63 0.11
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.15
72 0.14
73 0.16
74 0.18
75 0.18
76 0.18
77 0.18
78 0.17
79 0.17
80 0.19
81 0.22
82 0.24
83 0.24
84 0.24
85 0.29
86 0.28
87 0.24
88 0.24
89 0.18
90 0.14
91 0.14
92 0.13
93 0.08
94 0.08
95 0.08
96 0.06
97 0.05
98 0.05
99 0.04
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.05
106 0.06
107 0.07
108 0.07
109 0.1
110 0.1
111 0.13
112 0.13
113 0.13
114 0.17
115 0.16
116 0.17
117 0.14
118 0.14
119 0.11
120 0.13
121 0.14
122 0.1
123 0.12
124 0.12
125 0.15
126 0.17
127 0.22
128 0.26
129 0.26
130 0.3
131 0.29
132 0.29
133 0.27
134 0.26
135 0.21
136 0.16
137 0.16
138 0.13
139 0.13
140 0.11
141 0.1
142 0.09
143 0.12
144 0.13
145 0.11
146 0.1
147 0.13
148 0.14
149 0.2
150 0.24
151 0.25
152 0.29
153 0.39
154 0.46
155 0.49
156 0.57
157 0.63
158 0.69
159 0.76
160 0.81
161 0.83
162 0.83
163 0.86
164 0.83
165 0.81
166 0.79
167 0.78
168 0.72
169 0.67
170 0.59
171 0.53
172 0.51
173 0.46
174 0.37
175 0.27
176 0.22
177 0.16
178 0.16
179 0.13
180 0.1
181 0.08
182 0.08
183 0.11
184 0.12
185 0.13
186 0.14
187 0.15
188 0.18
189 0.17
190 0.18
191 0.15
192 0.15
193 0.19
194 0.18
195 0.18
196 0.15
197 0.15
198 0.14
199 0.15