Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164M991

Protein Details
Accession A0A164M991   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-62TTAPSRPKPKQVTKAKPKEVEHydrophilic
NLS Segment(s)
PositionSequence
27-34KGVAKGKP
Subcellular Location(s) cyto 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPGLISEKEFEDHLVAGWSRAGKGTGKGVAKGKPKETVTVATTAPSRPKPKQVTKAKPKEVEVTAEDEENDEDEDEEENEDEEEVDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.13
5 0.12
6 0.11
7 0.12
8 0.13
9 0.11
10 0.13
11 0.16
12 0.2
13 0.21
14 0.24
15 0.27
16 0.32
17 0.38
18 0.4
19 0.39
20 0.4
21 0.39
22 0.39
23 0.37
24 0.35
25 0.28
26 0.27
27 0.24
28 0.19
29 0.19
30 0.17
31 0.18
32 0.19
33 0.23
34 0.23
35 0.32
36 0.39
37 0.47
38 0.56
39 0.64
40 0.7
41 0.76
42 0.84
43 0.83
44 0.79
45 0.73
46 0.69
47 0.59
48 0.53
49 0.43
50 0.38
51 0.31
52 0.27
53 0.24
54 0.19
55 0.17
56 0.14
57 0.13
58 0.08
59 0.07
60 0.08
61 0.09
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.08
69 0.07