Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164V8F9

Protein Details
Accession A0A164V8F9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-40KADAILAKTGHKKKKRKNEDGANSFAPHydrophilic
NLS Segment(s)
PositionSequence
21-30KTGHKKKKRK
165-174RAEAARKKRE
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MQSYLASKYMSGPKADAILAKTGHKKKKRKNEDGANSFAPAIQEDDLGFGTEPTNDQTVDDSTEAVVASDRSFKKRKTDGSSEWATIWPGEGPKQRSASPAEEDKPLVVDQQEETPFKGGLLTSSQLKRRLPGAQSVKPTEASEQEQETVYRDASGRKIDTKAERAEAARKKRENEEKEAQKMQWGKGLVQREDEEKRRRELELEKTRDIARYADDADLNAHMKAEERWNDPAAAFLTKNRSKGPRKPMYNGPPPPPNRFGIRPGYRWDGVDRGNGFEKKLFQKGNDRQRRGLEAYQWSVDEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.27
4 0.2
5 0.23
6 0.23
7 0.27
8 0.36
9 0.42
10 0.52
11 0.59
12 0.67
13 0.72
14 0.82
15 0.88
16 0.89
17 0.91
18 0.92
19 0.93
20 0.89
21 0.85
22 0.76
23 0.65
24 0.54
25 0.45
26 0.34
27 0.23
28 0.19
29 0.12
30 0.11
31 0.1
32 0.11
33 0.11
34 0.11
35 0.1
36 0.08
37 0.08
38 0.08
39 0.09
40 0.1
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.15
47 0.14
48 0.12
49 0.11
50 0.12
51 0.11
52 0.09
53 0.08
54 0.06
55 0.07
56 0.14
57 0.16
58 0.22
59 0.28
60 0.31
61 0.4
62 0.47
63 0.55
64 0.55
65 0.62
66 0.62
67 0.64
68 0.65
69 0.57
70 0.5
71 0.42
72 0.34
73 0.25
74 0.2
75 0.14
76 0.11
77 0.15
78 0.2
79 0.23
80 0.28
81 0.3
82 0.31
83 0.32
84 0.35
85 0.33
86 0.32
87 0.34
88 0.31
89 0.3
90 0.3
91 0.27
92 0.24
93 0.2
94 0.17
95 0.11
96 0.1
97 0.09
98 0.14
99 0.17
100 0.16
101 0.16
102 0.17
103 0.16
104 0.15
105 0.15
106 0.1
107 0.08
108 0.09
109 0.1
110 0.13
111 0.17
112 0.21
113 0.25
114 0.25
115 0.26
116 0.26
117 0.31
118 0.27
119 0.33
120 0.37
121 0.38
122 0.42
123 0.43
124 0.41
125 0.36
126 0.35
127 0.27
128 0.22
129 0.2
130 0.17
131 0.16
132 0.15
133 0.15
134 0.14
135 0.15
136 0.13
137 0.11
138 0.1
139 0.09
140 0.1
141 0.12
142 0.14
143 0.13
144 0.15
145 0.16
146 0.19
147 0.23
148 0.26
149 0.26
150 0.24
151 0.25
152 0.24
153 0.31
154 0.34
155 0.38
156 0.42
157 0.43
158 0.45
159 0.51
160 0.6
161 0.57
162 0.58
163 0.6
164 0.59
165 0.61
166 0.61
167 0.53
168 0.48
169 0.46
170 0.38
171 0.32
172 0.26
173 0.23
174 0.24
175 0.31
176 0.26
177 0.26
178 0.26
179 0.27
180 0.32
181 0.38
182 0.42
183 0.39
184 0.42
185 0.41
186 0.41
187 0.4
188 0.42
189 0.45
190 0.47
191 0.5
192 0.47
193 0.48
194 0.48
195 0.45
196 0.39
197 0.29
198 0.21
199 0.17
200 0.18
201 0.17
202 0.16
203 0.15
204 0.15
205 0.16
206 0.14
207 0.12
208 0.1
209 0.08
210 0.09
211 0.11
212 0.17
213 0.2
214 0.23
215 0.26
216 0.27
217 0.28
218 0.27
219 0.28
220 0.22
221 0.2
222 0.17
223 0.17
224 0.25
225 0.28
226 0.3
227 0.33
228 0.41
229 0.47
230 0.56
231 0.63
232 0.64
233 0.67
234 0.71
235 0.76
236 0.76
237 0.79
238 0.76
239 0.72
240 0.71
241 0.7
242 0.71
243 0.64
244 0.58
245 0.54
246 0.5
247 0.5
248 0.51
249 0.53
250 0.5
251 0.52
252 0.55
253 0.5
254 0.48
255 0.45
256 0.4
257 0.36
258 0.39
259 0.34
260 0.32
261 0.38
262 0.38
263 0.36
264 0.34
265 0.38
266 0.37
267 0.44
268 0.43
269 0.4
270 0.5
271 0.59
272 0.67
273 0.71
274 0.71
275 0.69
276 0.71
277 0.74
278 0.69
279 0.65
280 0.61
281 0.58
282 0.57
283 0.53