Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164PAL3

Protein Details
Accession A0A164PAL3    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-94SYNSRNKRAKTDCHQKPKKNRPFQPPRWHSSCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MRRHVKIRLRMVQFPRVLLRVVTSPPPMPSSSPIALTSKKSYLLTRLDCQRAPSTVLSHSLSYNSRNKRAKTDCHQKPKKNRPFQPPRWHSSCPNEDLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.52
3 0.44
4 0.39
5 0.3
6 0.26
7 0.2
8 0.21
9 0.22
10 0.2
11 0.2
12 0.21
13 0.23
14 0.22
15 0.21
16 0.21
17 0.24
18 0.22
19 0.22
20 0.22
21 0.23
22 0.24
23 0.26
24 0.26
25 0.21
26 0.23
27 0.22
28 0.21
29 0.23
30 0.27
31 0.28
32 0.29
33 0.34
34 0.34
35 0.34
36 0.35
37 0.32
38 0.27
39 0.25
40 0.22
41 0.18
42 0.16
43 0.19
44 0.18
45 0.17
46 0.16
47 0.16
48 0.16
49 0.2
50 0.26
51 0.28
52 0.36
53 0.42
54 0.43
55 0.51
56 0.56
57 0.6
58 0.63
59 0.69
60 0.7
61 0.75
62 0.83
63 0.83
64 0.88
65 0.9
66 0.91
67 0.9
68 0.89
69 0.89
70 0.91
71 0.92
72 0.92
73 0.89
74 0.86
75 0.83
76 0.79
77 0.75
78 0.74
79 0.71