Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UQ91

Protein Details
Accession E4UQ91   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-59IRTWRGEKAKPSKGRRWKKLQLRKEAASHydrophilic
NLS Segment(s)
PositionSequence
36-61RGEKAKPSKGRRWKKLQLRKEAASKN
Subcellular Location(s) mito_nucl 12.499, nucl 12, mito 11.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MSRHRPSAPITELSREHQETIEDLLYRVLYPIRTWRGEKAKPSKGRRWKKLQLRKEAASKNKDEEKSSGHALTPSPAPDVLKYLTTGFNSTMRCLGGTDIYRNLTKAKGFDWSTYPKTPKREWQMLSVYPGWVSLELRNVNTLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.38
4 0.32
5 0.3
6 0.25
7 0.26
8 0.25
9 0.18
10 0.16
11 0.16
12 0.15
13 0.14
14 0.14
15 0.11
16 0.09
17 0.1
18 0.18
19 0.23
20 0.26
21 0.28
22 0.36
23 0.43
24 0.48
25 0.56
26 0.57
27 0.62
28 0.67
29 0.73
30 0.76
31 0.77
32 0.83
33 0.83
34 0.83
35 0.83
36 0.85
37 0.87
38 0.86
39 0.86
40 0.83
41 0.78
42 0.77
43 0.75
44 0.71
45 0.66
46 0.59
47 0.54
48 0.53
49 0.5
50 0.43
51 0.38
52 0.33
53 0.31
54 0.31
55 0.26
56 0.19
57 0.18
58 0.16
59 0.16
60 0.13
61 0.11
62 0.09
63 0.09
64 0.09
65 0.08
66 0.11
67 0.1
68 0.1
69 0.1
70 0.11
71 0.12
72 0.12
73 0.13
74 0.12
75 0.16
76 0.16
77 0.16
78 0.16
79 0.14
80 0.13
81 0.13
82 0.12
83 0.12
84 0.13
85 0.15
86 0.16
87 0.18
88 0.18
89 0.19
90 0.19
91 0.17
92 0.17
93 0.16
94 0.15
95 0.2
96 0.22
97 0.23
98 0.27
99 0.32
100 0.36
101 0.42
102 0.47
103 0.45
104 0.5
105 0.54
106 0.58
107 0.6
108 0.64
109 0.59
110 0.61
111 0.63
112 0.59
113 0.59
114 0.51
115 0.42
116 0.32
117 0.31
118 0.24
119 0.18
120 0.16
121 0.13
122 0.19
123 0.21
124 0.22
125 0.23