Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UQ82

Protein Details
Accession E4UQ82   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-40LSDPSSGRGHSRRHKRSRRKGGRRRRSDGNTDTBasic
NLS Segment(s)
PositionSequence
15-33RGHSRRHKRSRRKGGRRRR
71-77RSKREKP
Subcellular Location(s) nucl 19.5, mito_nucl 13.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MGSVTSNLSDPSSGRGHSRRHKRSRRKGGRRRRSDGNTDTALDMLIQVFVEYMKIEIENAKIRLSQAKESRSKREKPDSPVKTPKGRGYGDPMPIDSFEKADNLNEPGYRHSSDSDNHFDVQHRHGVLGRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.36
4 0.46
5 0.56
6 0.63
7 0.71
8 0.81
9 0.86
10 0.91
11 0.94
12 0.96
13 0.96
14 0.96
15 0.96
16 0.96
17 0.95
18 0.9
19 0.88
20 0.84
21 0.82
22 0.75
23 0.7
24 0.61
25 0.52
26 0.46
27 0.36
28 0.28
29 0.19
30 0.14
31 0.08
32 0.05
33 0.04
34 0.03
35 0.03
36 0.03
37 0.04
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.08
45 0.11
46 0.12
47 0.12
48 0.13
49 0.13
50 0.18
51 0.19
52 0.23
53 0.24
54 0.3
55 0.38
56 0.41
57 0.5
58 0.53
59 0.57
60 0.58
61 0.63
62 0.63
63 0.63
64 0.7
65 0.67
66 0.68
67 0.72
68 0.7
69 0.67
70 0.65
71 0.62
72 0.58
73 0.53
74 0.47
75 0.45
76 0.45
77 0.43
78 0.4
79 0.35
80 0.29
81 0.29
82 0.29
83 0.21
84 0.16
85 0.12
86 0.12
87 0.12
88 0.12
89 0.13
90 0.13
91 0.15
92 0.16
93 0.16
94 0.19
95 0.23
96 0.23
97 0.22
98 0.22
99 0.24
100 0.25
101 0.31
102 0.35
103 0.33
104 0.32
105 0.32
106 0.34
107 0.34
108 0.35
109 0.34
110 0.28
111 0.26
112 0.28