Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165GTM6

Protein Details
Accession A0A165GTM6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29ISSQSHKTFRTKQKLAKAQKQNRPIPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 11.833, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MRISSQSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIGYNAKRRHWRKTRLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.81
4 0.82
5 0.82
6 0.83
7 0.82
8 0.82
9 0.84
10 0.81
11 0.78
12 0.73
13 0.7
14 0.63
15 0.62
16 0.62
17 0.55
18 0.53
19 0.49
20 0.47
21 0.42
22 0.42
23 0.38
24 0.31
25 0.31
26 0.3
27 0.33
28 0.39
29 0.39
30 0.42
31 0.48
32 0.52
33 0.6
34 0.66
35 0.71