Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165HV90

Protein Details
Accession A0A165HV90    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
20-72KTTTTTKDTKKKESKERKGKERKGKERRGERSKTKESREKEKNRRQHLSHVLVBasic
NLS Segment(s)
PositionSequence
29-64KKKESKERKGKERKGKERRGERSKTKESREKEKNRR
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 10.333, cyto 6.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MIGVLGFAVSETVLLKTMTKTTTTTKDTKKKESKERKGKERKGKERRGERSKTKESREKEKNRRQHLSHVLVFLFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.12
5 0.13
6 0.14
7 0.16
8 0.19
9 0.26
10 0.3
11 0.37
12 0.43
13 0.51
14 0.55
15 0.63
16 0.68
17 0.69
18 0.75
19 0.79
20 0.81
21 0.83
22 0.86
23 0.87
24 0.89
25 0.89
26 0.89
27 0.89
28 0.89
29 0.89
30 0.9
31 0.88
32 0.88
33 0.89
34 0.87
35 0.85
36 0.84
37 0.83
38 0.83
39 0.82
40 0.8
41 0.78
42 0.74
43 0.76
44 0.77
45 0.79
46 0.8
47 0.82
48 0.84
49 0.85
50 0.89
51 0.82
52 0.82
53 0.81
54 0.78
55 0.71
56 0.65