Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165J4I2

Protein Details
Accession A0A165J4I2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-93LKAVPKKKTSHMKKRHRQMAGKGBasic
NLS Segment(s)
PositionSequence
75-90PKKKTSHMKKRHRQMA
Subcellular Location(s) plas 14, mito 8, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALSISSAVRSSLPAVAPLISSEATAFASRSAMLQTRRFALPLLPSISFAIPVAIHLNIPSIIPGLWESILKAVPKKKTSHMKKRHRQMAGKGLKDVTSLNRCSSCGNVKRAHILCPHCVKGKKLYWQCKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.13
6 0.14
7 0.1
8 0.1
9 0.09
10 0.08
11 0.09
12 0.1
13 0.09
14 0.07
15 0.08
16 0.08
17 0.08
18 0.1
19 0.13
20 0.17
21 0.21
22 0.22
23 0.25
24 0.26
25 0.25
26 0.24
27 0.21
28 0.2
29 0.2
30 0.21
31 0.18
32 0.18
33 0.19
34 0.19
35 0.16
36 0.13
37 0.1
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.05
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.08
58 0.08
59 0.12
60 0.16
61 0.21
62 0.25
63 0.28
64 0.35
65 0.44
66 0.54
67 0.62
68 0.68
69 0.74
70 0.79
71 0.87
72 0.88
73 0.86
74 0.82
75 0.79
76 0.79
77 0.76
78 0.68
79 0.6
80 0.52
81 0.44
82 0.38
83 0.32
84 0.28
85 0.26
86 0.26
87 0.27
88 0.27
89 0.28
90 0.28
91 0.31
92 0.34
93 0.35
94 0.39
95 0.41
96 0.42
97 0.51
98 0.51
99 0.51
100 0.49
101 0.46
102 0.48
103 0.51
104 0.53
105 0.52
106 0.55
107 0.53
108 0.55
109 0.59
110 0.61
111 0.64