Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165AHW5

Protein Details
Accession A0A165AHW5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-113IPSKFDPKRILKKIKKDFACHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 17, nucl 13, cyto 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
IPR005874  SUI1_euk  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11566  eIF1_SUI1  
Amino Acid Sequences MERLEFNYFVQNTFADEGATGNPQLENDSKGTSSSTPKSVKKPSEKKSAAKQESGGIEIENFKTFDPFAEEGVSGESKDSTDNYIHIRIQLQGIPSKFDPKRILKKIKKDFACNGTVIHDVTMGEVIQLQGDQRKVSQEFLCDKQNGLGLDAKTIKVHGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.12
3 0.12
4 0.12
5 0.12
6 0.13
7 0.1
8 0.09
9 0.1
10 0.09
11 0.12
12 0.13
13 0.14
14 0.14
15 0.16
16 0.16
17 0.16
18 0.18
19 0.17
20 0.22
21 0.23
22 0.28
23 0.33
24 0.38
25 0.45
26 0.52
27 0.58
28 0.63
29 0.7
30 0.7
31 0.75
32 0.76
33 0.75
34 0.76
35 0.78
36 0.71
37 0.63
38 0.57
39 0.5
40 0.45
41 0.4
42 0.3
43 0.19
44 0.16
45 0.15
46 0.15
47 0.11
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.13
60 0.13
61 0.08
62 0.07
63 0.06
64 0.05
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.1
71 0.13
72 0.13
73 0.13
74 0.13
75 0.12
76 0.13
77 0.13
78 0.13
79 0.14
80 0.14
81 0.17
82 0.16
83 0.24
84 0.23
85 0.27
86 0.33
87 0.38
88 0.48
89 0.54
90 0.65
91 0.64
92 0.75
93 0.79
94 0.81
95 0.78
96 0.74
97 0.72
98 0.66
99 0.61
100 0.51
101 0.42
102 0.35
103 0.32
104 0.25
105 0.18
106 0.14
107 0.1
108 0.1
109 0.1
110 0.07
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.06
117 0.09
118 0.11
119 0.12
120 0.12
121 0.19
122 0.2
123 0.25
124 0.25
125 0.28
126 0.33
127 0.36
128 0.42
129 0.36
130 0.36
131 0.33
132 0.35
133 0.29
134 0.26
135 0.28
136 0.21
137 0.27
138 0.28
139 0.26
140 0.23