Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165FQZ2

Protein Details
Accession A0A165FQZ2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-95AASKREIRKIMKKRKVNFDEARHydrophilic
NLS Segment(s)
PositionSequence
77-88KREIRKIMKKRK
Subcellular Location(s) extr 13, plas 6, E.R. 3, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018559  DUF2015  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09435  DUF2015  
Amino Acid Sequences MSYILYSLSLTFLIVATVLWFTRQRWVHLVPVPGYIYERLPSTFAGDIEAGFSSNAFDLSSNLAAGDSRAGLDAASKREIRKIMKKRKVNFDEARRIFTEQSFAKNNIGPDGRPRDPKFVSFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.06
6 0.08
7 0.1
8 0.1
9 0.19
10 0.21
11 0.24
12 0.28
13 0.31
14 0.35
15 0.38
16 0.41
17 0.34
18 0.35
19 0.32
20 0.27
21 0.26
22 0.2
23 0.17
24 0.14
25 0.14
26 0.11
27 0.12
28 0.12
29 0.13
30 0.13
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.1
37 0.07
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.06
60 0.09
61 0.11
62 0.14
63 0.15
64 0.16
65 0.2
66 0.25
67 0.29
68 0.37
69 0.46
70 0.54
71 0.62
72 0.71
73 0.75
74 0.81
75 0.81
76 0.8
77 0.78
78 0.77
79 0.78
80 0.71
81 0.68
82 0.59
83 0.55
84 0.47
85 0.38
86 0.36
87 0.26
88 0.3
89 0.3
90 0.3
91 0.31
92 0.32
93 0.32
94 0.32
95 0.32
96 0.27
97 0.32
98 0.38
99 0.41
100 0.48
101 0.51
102 0.53
103 0.54