Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165G161

Protein Details
Accession A0A165G161   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-36WKVPWRLSRMQKLRQRERLRHydrophilic
76-105DKYTIFDRKEKKYRKGIHKLPKWTRLSQRLHydrophilic
NLS Segment(s)
PositionSequence
83-97RKEKKYRKGIHKLPK
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATNPLSGGLLWKVPWRLSRMQKLRQRERLRAVDNVVATIDRALAKQGETAKAIERWKNEMPAEPEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRLSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.23
8 0.26
9 0.33
10 0.4
11 0.5
12 0.55
13 0.63
14 0.67
15 0.74
16 0.79
17 0.81
18 0.79
19 0.76
20 0.76
21 0.75
22 0.71
23 0.64
24 0.56
25 0.49
26 0.42
27 0.34
28 0.26
29 0.17
30 0.14
31 0.11
32 0.09
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.11
40 0.11
41 0.12
42 0.13
43 0.13
44 0.17
45 0.2
46 0.2
47 0.2
48 0.24
49 0.25
50 0.29
51 0.28
52 0.28
53 0.29
54 0.29
55 0.29
56 0.24
57 0.25
58 0.23
59 0.24
60 0.21
61 0.17
62 0.17
63 0.16
64 0.19
65 0.23
66 0.3
67 0.32
68 0.4
69 0.47
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79