Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165IGD2

Protein Details
Accession A0A165IGD2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
61-80RMCMDTKKPKVEKRNTINYHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKTTTKAPMRLPPLPKLRVRHPNKTETNPCMAIMSSMLGCWASSGYNMAGCVGLEQQLRMCMDTKKPKVEKRNTINYHLSRLYPKIIGPHKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.63
4 0.63
5 0.6
6 0.62
7 0.65
8 0.68
9 0.7
10 0.68
11 0.71
12 0.72
13 0.76
14 0.74
15 0.67
16 0.65
17 0.55
18 0.49
19 0.4
20 0.33
21 0.24
22 0.16
23 0.13
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.07
43 0.07
44 0.07
45 0.07
46 0.1
47 0.1
48 0.11
49 0.12
50 0.12
51 0.21
52 0.31
53 0.35
54 0.43
55 0.5
56 0.57
57 0.66
58 0.74
59 0.76
60 0.75
61 0.81
62 0.77
63 0.76
64 0.78
65 0.69
66 0.66
67 0.58
68 0.51
69 0.45
70 0.43
71 0.39
72 0.31
73 0.3
74 0.33
75 0.4