Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GND2

Protein Details
Accession A0A165GND2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-125GPRKNQNNLTKEKENKKNKKEKBasic
NLS Segment(s)
PositionSequence
114-125KEKENKKNKKEK
Subcellular Location(s) mito 7, golg 5, extr 4, E.R. 4, cyto_mito 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAMQHGCLYSLLFPPLPLGSKFLFLFLRRPSFLLLFFCLVIFLLHFLVPPPRAPHISHLASLPLQHPAPSLFSAGLSPASTSLPPYPPLNFLLSLGPKTSNPGPRKNQNNLTKEKENKKNKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.17
5 0.16
6 0.17
7 0.15
8 0.19
9 0.19
10 0.2
11 0.22
12 0.2
13 0.25
14 0.27
15 0.32
16 0.29
17 0.3
18 0.3
19 0.28
20 0.28
21 0.25
22 0.22
23 0.17
24 0.17
25 0.15
26 0.13
27 0.12
28 0.1
29 0.07
30 0.06
31 0.05
32 0.05
33 0.05
34 0.06
35 0.08
36 0.09
37 0.1
38 0.12
39 0.14
40 0.16
41 0.17
42 0.21
43 0.25
44 0.26
45 0.25
46 0.23
47 0.21
48 0.19
49 0.19
50 0.16
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.1
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.06
65 0.06
66 0.06
67 0.07
68 0.06
69 0.08
70 0.1
71 0.11
72 0.14
73 0.15
74 0.16
75 0.17
76 0.19
77 0.2
78 0.18
79 0.17
80 0.2
81 0.2
82 0.2
83 0.19
84 0.19
85 0.16
86 0.21
87 0.26
88 0.3
89 0.34
90 0.42
91 0.5
92 0.58
93 0.67
94 0.71
95 0.75
96 0.76
97 0.78
98 0.77
99 0.77
100 0.77
101 0.78
102 0.79
103 0.79
104 0.81
105 0.84