Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165I259

Protein Details
Accession A0A165I259    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-126AATKIEKASRQQRKQRKNRSKTVRGTAKAKHydrophilic
NLS Segment(s)
PositionSequence
101-133IEKASRQQRKQRKNRSKTVRGTAKAKGVKKEKK
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADQPVTLRTRKFIRNPLLGRKQMVVDILHPNRANISKDELRGKLAELYKASQDQVNVFGLRTHYGGGKTTGFALLYDSAEALKTFEPHYRQVRIGAATKIEKASRQQRKQRKNRSKTVRGTAKAKGVKKEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.69
4 0.74
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.31
26 0.36
27 0.33
28 0.32
29 0.3
30 0.29
31 0.27
32 0.25
33 0.24
34 0.2
35 0.21
36 0.21
37 0.21
38 0.21
39 0.16
40 0.15
41 0.13
42 0.14
43 0.14
44 0.12
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.09
51 0.09
52 0.09
53 0.1
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.12
74 0.15
75 0.21
76 0.27
77 0.29
78 0.29
79 0.31
80 0.33
81 0.32
82 0.33
83 0.28
84 0.26
85 0.25
86 0.26
87 0.26
88 0.24
89 0.23
90 0.27
91 0.36
92 0.43
93 0.51
94 0.6
95 0.68
96 0.79
97 0.87
98 0.91
99 0.92
100 0.91
101 0.92
102 0.92
103 0.92
104 0.9
105 0.9
106 0.89
107 0.84
108 0.79
109 0.75
110 0.73
111 0.71
112 0.67
113 0.66