Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165HNR8

Protein Details
Accession A0A165HNR8   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-46APGMRKNGKQWHQPKRPFRPHAGLHydrophilic
100-124LAQKMHHKRVERLRRREKRNKLLNSBasic
NLS Segment(s)
PositionSequence
28-120KNGKQWHQPKRPFRPHAGLTSYAKRAEERKQLAAIKSKEKEMKDEKEAERKQRIQAIKDRRQKKEEKERYEMLAQKMHHKRVERLRRREKRNK
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTDTAATATASTPAEQPGSTVAPGMRKNGKQWHQPKRPFRPHAGLTSYAKRAEERKQLAAIKSKEKEMKDEKEAERKQRIQAIKDRRQKKEEKERYEMLAQKMHHKRVERLRRREKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.13
5 0.13
6 0.14
7 0.13
8 0.14
9 0.14
10 0.19
11 0.2
12 0.25
13 0.29
14 0.29
15 0.35
16 0.43
17 0.49
18 0.53
19 0.62
20 0.68
21 0.71
22 0.79
23 0.83
24 0.85
25 0.88
26 0.84
27 0.8
28 0.77
29 0.7
30 0.67
31 0.61
32 0.54
33 0.47
34 0.46
35 0.42
36 0.34
37 0.31
38 0.27
39 0.26
40 0.29
41 0.33
42 0.32
43 0.32
44 0.36
45 0.38
46 0.39
47 0.44
48 0.4
49 0.38
50 0.35
51 0.37
52 0.37
53 0.35
54 0.39
55 0.38
56 0.4
57 0.38
58 0.44
59 0.43
60 0.49
61 0.53
62 0.53
63 0.55
64 0.53
65 0.52
66 0.52
67 0.52
68 0.47
69 0.52
70 0.56
71 0.57
72 0.64
73 0.69
74 0.69
75 0.72
76 0.75
77 0.76
78 0.77
79 0.78
80 0.76
81 0.75
82 0.71
83 0.69
84 0.68
85 0.63
86 0.55
87 0.5
88 0.43
89 0.46
90 0.51
91 0.53
92 0.51
93 0.5
94 0.55
95 0.6
96 0.71
97 0.71
98 0.75
99 0.8
100 0.84
101 0.91
102 0.93
103 0.93
104 0.93