Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165HWB7

Protein Details
Accession A0A165HWB7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPAGKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-18KQKKKWSKGKVKD
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAGKQKKKWSKGKVKDKAQHAVVFDKSTSDRLNKDVQSYRLITVAVLVDRLKINGSLARKALADLEERGVIKKVVNHHALDVYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.89
5 0.86
6 0.82
7 0.76
8 0.68
9 0.59
10 0.54
11 0.45
12 0.38
13 0.31
14 0.25
15 0.22
16 0.21
17 0.21
18 0.19
19 0.18
20 0.2
21 0.26
22 0.25
23 0.3
24 0.31
25 0.31
26 0.32
27 0.32
28 0.29
29 0.24
30 0.23
31 0.17
32 0.13
33 0.12
34 0.08
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.1
44 0.13
45 0.14
46 0.15
47 0.16
48 0.15
49 0.15
50 0.16
51 0.14
52 0.14
53 0.13
54 0.14
55 0.16
56 0.16
57 0.17
58 0.16
59 0.15
60 0.15
61 0.17
62 0.22
63 0.27
64 0.31
65 0.31
66 0.32
67 0.34
68 0.33
69 0.32
70 0.27
71 0.21
72 0.17