Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165H3U3

Protein Details
Accession A0A165H3U3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-64SLAVKSTKERKRNDNNNKRKARDDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQRINSKDCEPSAAKARTGNDRNTTSNAPTRDPSYYMTCSLAVKSTKERKRNDNNNKRKARDDTRLCEGGRRETNAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.4
4 0.43
5 0.46
6 0.47
7 0.44
8 0.45
9 0.46
10 0.46
11 0.46
12 0.39
13 0.4
14 0.36
15 0.32
16 0.29
17 0.29
18 0.26
19 0.25
20 0.25
21 0.23
22 0.23
23 0.22
24 0.21
25 0.2
26 0.18
27 0.17
28 0.18
29 0.14
30 0.14
31 0.21
32 0.3
33 0.37
34 0.45
35 0.5
36 0.56
37 0.66
38 0.76
39 0.79
40 0.8
41 0.84
42 0.87
43 0.91
44 0.85
45 0.81
46 0.79
47 0.76
48 0.75
49 0.74
50 0.7
51 0.68
52 0.69
53 0.63
54 0.6
55 0.54
56 0.53
57 0.5