Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FHS6

Protein Details
Accession A0A165FHS6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23DSSPARTLQRRPKKLGFRRDSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto_mito 13.166, mito_nucl 12.166, cyto 4, cyto_nucl 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences MDSSPARTLQRRPKKLGFRRDSYWCIVTGAVELSVEHGAMYATDEIATTELALTILFSLGQWDNDRKKQAVAQILPTLKKGFPSMDSGPTNVNKPKNLMTLVNTVHTKFGPFCLALEPATYLPFEQKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.84
5 0.79
6 0.77
7 0.76
8 0.71
9 0.65
10 0.56
11 0.46
12 0.38
13 0.32
14 0.26
15 0.19
16 0.15
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.06
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.05
46 0.05
47 0.06
48 0.08
49 0.12
50 0.16
51 0.2
52 0.22
53 0.2
54 0.21
55 0.22
56 0.26
57 0.28
58 0.26
59 0.26
60 0.29
61 0.31
62 0.3
63 0.29
64 0.26
65 0.19
66 0.19
67 0.18
68 0.14
69 0.13
70 0.19
71 0.2
72 0.25
73 0.26
74 0.26
75 0.28
76 0.28
77 0.3
78 0.3
79 0.31
80 0.26
81 0.28
82 0.31
83 0.31
84 0.33
85 0.31
86 0.29
87 0.32
88 0.32
89 0.33
90 0.31
91 0.28
92 0.27
93 0.25
94 0.23
95 0.17
96 0.18
97 0.17
98 0.16
99 0.16
100 0.17
101 0.19
102 0.17
103 0.17
104 0.18
105 0.15
106 0.15
107 0.15
108 0.12
109 0.15