Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4UV25

Protein Details
Accession E4UV25    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKSSRSTIKGPKKSEPLBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRSTIKGPKK
Subcellular Location(s) cyto 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRSTIKGPKKSEPLPTTFDCLFCNHENCVLVKLNKKLGFGNLSCKICGQRFQTGINYLSAAVDVYSDWVDACDAVAKEGPKEGAGSSVGRADHDGPSASAAPAVVDDGLDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.78
4 0.74
5 0.74
6 0.68
7 0.61
8 0.58
9 0.55
10 0.52
11 0.45
12 0.41
13 0.32
14 0.29
15 0.29
16 0.26
17 0.26
18 0.21
19 0.23
20 0.23
21 0.22
22 0.24
23 0.23
24 0.23
25 0.26
26 0.29
27 0.34
28 0.34
29 0.35
30 0.33
31 0.31
32 0.33
33 0.28
34 0.32
35 0.31
36 0.3
37 0.29
38 0.29
39 0.28
40 0.24
41 0.29
42 0.25
43 0.24
44 0.24
45 0.26
46 0.28
47 0.28
48 0.27
49 0.22
50 0.19
51 0.14
52 0.12
53 0.1
54 0.07
55 0.05
56 0.04
57 0.03
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.07
67 0.07
68 0.08
69 0.1
70 0.1
71 0.11
72 0.12
73 0.13
74 0.1
75 0.11
76 0.1
77 0.1
78 0.11
79 0.11
80 0.11
81 0.13
82 0.13
83 0.13
84 0.15
85 0.15
86 0.15
87 0.16
88 0.16
89 0.13
90 0.16
91 0.16
92 0.14
93 0.13
94 0.11
95 0.1
96 0.09
97 0.09
98 0.06
99 0.05
100 0.05