Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165JSC5

Protein Details
Accession A0A165JSC5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-86AGPVWLQLCRQRRRRRRPSARAPYAGRVHydrophilic
NLS Segment(s)
PositionSequence
70-79RRRRRRPSAR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, extr 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MICSDKSALLICNRDTPALPLPLPLPSTSYQYYTFNFAKRPAYLLTSYHALFFYSRSLAGPVWLQLCRQRRRRRRPSARAPYAGRVDIFDPRILDQTLVGPHPQHHVRRSFIDDAICI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.3
4 0.29
5 0.29
6 0.27
7 0.22
8 0.22
9 0.23
10 0.24
11 0.2
12 0.18
13 0.15
14 0.2
15 0.2
16 0.22
17 0.22
18 0.23
19 0.24
20 0.27
21 0.28
22 0.25
23 0.26
24 0.26
25 0.27
26 0.25
27 0.26
28 0.21
29 0.22
30 0.21
31 0.2
32 0.2
33 0.19
34 0.19
35 0.17
36 0.15
37 0.12
38 0.11
39 0.11
40 0.1
41 0.08
42 0.08
43 0.07
44 0.09
45 0.08
46 0.09
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.15
53 0.24
54 0.31
55 0.41
56 0.51
57 0.6
58 0.71
59 0.81
60 0.87
61 0.89
62 0.92
63 0.94
64 0.94
65 0.92
66 0.88
67 0.8
68 0.75
69 0.68
70 0.58
71 0.47
72 0.37
73 0.3
74 0.27
75 0.25
76 0.2
77 0.18
78 0.17
79 0.2
80 0.19
81 0.17
82 0.13
83 0.15
84 0.16
85 0.16
86 0.16
87 0.15
88 0.16
89 0.23
90 0.29
91 0.32
92 0.37
93 0.42
94 0.45
95 0.49
96 0.55
97 0.52
98 0.47