Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UQG0

Protein Details
Accession E4UQG0   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-106TATMRRRSQKQLVLNRKRMQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000582  Acyl-CoA-binding_protein  
IPR035984  Acyl-CoA-binding_sf  
IPR014352  FERM/acyl-CoA-bd_prot_sf  
Gene Ontology GO:0000062  F:fatty-acyl-CoA binding  
Pfam View protein in Pfam  
PF00887  ACBP  
PROSITE View protein in PROSITE  
PS51228  ACB_2  
Amino Acid Sequences MSDTDFKAAAEASRRLLAKPSNDELLKLYALYKQGTQDPPFEKAPSPGMFDMKGSQVQRVEAVAEVELPQRAKVEYIALVEPSRPSTATMRRRSQKQLVLNRKRMQHTLRSPEGKGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.29
4 0.31
5 0.32
6 0.37
7 0.38
8 0.4
9 0.39
10 0.39
11 0.36
12 0.34
13 0.27
14 0.21
15 0.18
16 0.14
17 0.16
18 0.16
19 0.15
20 0.15
21 0.2
22 0.25
23 0.26
24 0.29
25 0.3
26 0.33
27 0.33
28 0.32
29 0.27
30 0.24
31 0.27
32 0.23
33 0.24
34 0.21
35 0.2
36 0.19
37 0.19
38 0.18
39 0.15
40 0.17
41 0.14
42 0.15
43 0.14
44 0.14
45 0.14
46 0.13
47 0.12
48 0.08
49 0.08
50 0.06
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.11
64 0.11
65 0.12
66 0.12
67 0.12
68 0.12
69 0.12
70 0.12
71 0.1
72 0.12
73 0.17
74 0.27
75 0.36
76 0.44
77 0.52
78 0.58
79 0.64
80 0.7
81 0.73
82 0.71
83 0.71
84 0.74
85 0.76
86 0.79
87 0.82
88 0.8
89 0.79
90 0.76
91 0.74
92 0.69
93 0.68
94 0.67
95 0.67
96 0.71
97 0.68
98 0.64