Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165FRT0

Protein Details
Accession A0A165FRT0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
309-329GSNSGKPKQKKVESPAPPAVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007317  GET4  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0045048  P:protein insertion into ER membrane  
Pfam View protein in Pfam  
PF04190  GET4  
Amino Acid Sequences MASARIEKTIARQRQKIEEGQYYEAHQQLRVITSRYIKQENYASAIDILSSGALALLNAGQGGSGGDLSMFLMDVYNKAELKPDSGNKGRLTDLLRAFPVEEPTRKRFVNEMISWSSKFGEFAAGDPELHHVAGTLYAEDQEPYDAERHLTLGTRDSAEVLARLEYEWYTQDESHTAGLYAARAVFPYLLVGNLRAANKALLLFTSRLSQSSGSLGVQEVSSASSDVRLYPSLPLLNFLSLLLLAVQRGSADLFRQLKTHYAVHIKDVGIWDEALEQVGEMYFGIRIPRPGNPLFDMMGSLFMGGGAGGSNSGKPKQKKVESPAPPAVDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.68
4 0.65
5 0.64
6 0.6
7 0.58
8 0.54
9 0.48
10 0.46
11 0.42
12 0.36
13 0.28
14 0.25
15 0.23
16 0.26
17 0.25
18 0.24
19 0.25
20 0.3
21 0.35
22 0.4
23 0.43
24 0.39
25 0.41
26 0.45
27 0.43
28 0.42
29 0.36
30 0.31
31 0.27
32 0.26
33 0.2
34 0.14
35 0.12
36 0.07
37 0.06
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.05
62 0.07
63 0.1
64 0.1
65 0.1
66 0.15
67 0.15
68 0.18
69 0.23
70 0.26
71 0.31
72 0.35
73 0.4
74 0.37
75 0.39
76 0.37
77 0.35
78 0.34
79 0.34
80 0.32
81 0.29
82 0.28
83 0.26
84 0.26
85 0.23
86 0.25
87 0.22
88 0.25
89 0.28
90 0.33
91 0.37
92 0.36
93 0.36
94 0.34
95 0.36
96 0.39
97 0.35
98 0.36
99 0.35
100 0.38
101 0.36
102 0.34
103 0.29
104 0.2
105 0.18
106 0.13
107 0.13
108 0.1
109 0.11
110 0.13
111 0.12
112 0.12
113 0.12
114 0.14
115 0.11
116 0.1
117 0.09
118 0.06
119 0.06
120 0.07
121 0.07
122 0.05
123 0.04
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.07
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.09
138 0.08
139 0.09
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.09
146 0.09
147 0.07
148 0.06
149 0.05
150 0.06
151 0.06
152 0.05
153 0.06
154 0.06
155 0.07
156 0.09
157 0.08
158 0.09
159 0.09
160 0.1
161 0.1
162 0.09
163 0.08
164 0.06
165 0.07
166 0.06
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.1
181 0.1
182 0.1
183 0.1
184 0.1
185 0.1
186 0.1
187 0.09
188 0.06
189 0.08
190 0.08
191 0.09
192 0.11
193 0.11
194 0.11
195 0.13
196 0.13
197 0.11
198 0.12
199 0.13
200 0.1
201 0.1
202 0.1
203 0.09
204 0.08
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.06
212 0.06
213 0.07
214 0.09
215 0.09
216 0.1
217 0.1
218 0.13
219 0.14
220 0.14
221 0.16
222 0.15
223 0.14
224 0.14
225 0.13
226 0.1
227 0.08
228 0.08
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.04
235 0.05
236 0.06
237 0.06
238 0.06
239 0.14
240 0.17
241 0.18
242 0.2
243 0.2
244 0.24
245 0.27
246 0.28
247 0.26
248 0.3
249 0.31
250 0.33
251 0.36
252 0.32
253 0.31
254 0.3
255 0.27
256 0.2
257 0.19
258 0.16
259 0.12
260 0.12
261 0.1
262 0.08
263 0.06
264 0.05
265 0.05
266 0.05
267 0.04
268 0.04
269 0.04
270 0.05
271 0.08
272 0.09
273 0.13
274 0.15
275 0.2
276 0.26
277 0.28
278 0.32
279 0.32
280 0.34
281 0.31
282 0.29
283 0.26
284 0.2
285 0.19
286 0.14
287 0.11
288 0.08
289 0.07
290 0.07
291 0.05
292 0.05
293 0.03
294 0.03
295 0.04
296 0.05
297 0.07
298 0.11
299 0.17
300 0.26
301 0.31
302 0.41
303 0.5
304 0.59
305 0.67
306 0.73
307 0.78
308 0.78
309 0.82
310 0.81
311 0.74