Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165HRT3

Protein Details
Accession A0A165HRT3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-31APNPRATNACQSCRRRKVKCSGEQPCRSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MVAPNPRATNACQSCRRRKVKCSGEQPCRSCSRHNWECTFGHVGRKRYSEAYVCTSLCEQYPFIDRREAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.74
3 0.8
4 0.76
5 0.78
6 0.8
7 0.81
8 0.82
9 0.82
10 0.82
11 0.83
12 0.84
13 0.78
14 0.72
15 0.68
16 0.61
17 0.53
18 0.5
19 0.5
20 0.48
21 0.51
22 0.49
23 0.47
24 0.45
25 0.45
26 0.43
27 0.34
28 0.36
29 0.36
30 0.38
31 0.38
32 0.39
33 0.38
34 0.35
35 0.38
36 0.33
37 0.32
38 0.33
39 0.33
40 0.31
41 0.3
42 0.29
43 0.27
44 0.24
45 0.22
46 0.16
47 0.15
48 0.23
49 0.23
50 0.25