Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FC65

Protein Details
Accession A0A165FC65   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-69VKKIIEKRKKHWNKGESKISERBasic
NLS Segment(s)
PositionSequence
51-65IIEKRKKHWNKGESK
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MHHVVRRNPSNAVVPRIFAFPILFYPFHPYRVATFVMTNLSMHHSNVVKKIIEKRKKHWNKGESKISERKIGNFFANNANKVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.34
4 0.31
5 0.23
6 0.18
7 0.12
8 0.14
9 0.16
10 0.15
11 0.14
12 0.21
13 0.21
14 0.23
15 0.23
16 0.21
17 0.19
18 0.22
19 0.22
20 0.16
21 0.15
22 0.14
23 0.14
24 0.14
25 0.12
26 0.09
27 0.11
28 0.11
29 0.1
30 0.12
31 0.13
32 0.14
33 0.17
34 0.19
35 0.16
36 0.19
37 0.28
38 0.36
39 0.44
40 0.48
41 0.51
42 0.6
43 0.7
44 0.77
45 0.77
46 0.77
47 0.77
48 0.82
49 0.86
50 0.8
51 0.78
52 0.77
53 0.7
54 0.68
55 0.6
56 0.56
57 0.5
58 0.48
59 0.45
60 0.39
61 0.39
62 0.41
63 0.46
64 0.41