Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GWA1

Protein Details
Accession A0A165GWA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSTRKPQGPKKSVTVKLBasic
NLS Segment(s)
PositionSequence
3-17KRKKSTRKPQGPKKS
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSTRKPQGPKKSVTVKLEKKIGVGQLSCKVCGQSFQTGINYLSAAVDVYSDWIDACDTVAKDAAGDDPRDSSYGYHEPESRLAVEDYADREPLAATEGSIDDDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.83
4 0.8
5 0.76
6 0.75
7 0.72
8 0.7
9 0.71
10 0.62
11 0.54
12 0.49
13 0.46
14 0.39
15 0.32
16 0.29
17 0.3
18 0.31
19 0.3
20 0.27
21 0.24
22 0.2
23 0.21
24 0.21
25 0.18
26 0.19
27 0.2
28 0.2
29 0.21
30 0.21
31 0.19
32 0.15
33 0.11
34 0.09
35 0.07
36 0.06
37 0.04
38 0.04
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.06
54 0.07
55 0.1
56 0.09
57 0.1
58 0.1
59 0.11
60 0.12
61 0.13
62 0.13
63 0.1
64 0.14
65 0.18
66 0.2
67 0.22
68 0.23
69 0.24
70 0.26
71 0.27
72 0.22
73 0.2
74 0.18
75 0.15
76 0.14
77 0.15
78 0.16
79 0.16
80 0.15
81 0.13
82 0.13
83 0.13
84 0.12
85 0.12
86 0.09
87 0.08
88 0.09
89 0.1
90 0.12