Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165A7L1

Protein Details
Accession A0A165A7L1   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-36VNVPKTRRTYCKGKDCKKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MAIFSQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.64
4 0.73
5 0.76
6 0.8
7 0.82
8 0.82
9 0.87
10 0.86
11 0.87
12 0.87
13 0.87
14 0.85
15 0.85
16 0.88
17 0.8
18 0.79
19 0.73
20 0.68
21 0.6
22 0.54
23 0.44
24 0.35
25 0.33
26 0.33
27 0.31
28 0.28
29 0.33
30 0.37
31 0.41
32 0.46
33 0.5
34 0.47
35 0.53
36 0.6
37 0.58
38 0.59
39 0.58
40 0.57
41 0.55
42 0.58
43 0.49
44 0.44
45 0.4
46 0.33
47 0.35
48 0.37
49 0.36
50 0.31
51 0.38
52 0.42
53 0.5
54 0.59
55 0.62
56 0.62
57 0.65
58 0.72
59 0.73
60 0.71
61 0.68
62 0.64
63 0.64
64 0.65
65 0.63
66 0.58
67 0.55
68 0.5
69 0.46
70 0.44
71 0.41
72 0.41
73 0.45
74 0.48
75 0.51
76 0.6
77 0.66
78 0.69
79 0.66
80 0.61
81 0.56
82 0.51
83 0.49
84 0.49
85 0.5
86 0.51
87 0.54
88 0.52
89 0.49
90 0.48
91 0.42