Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A164ZUJ5

Protein Details
Accession A0A164ZUJ5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-39YNCHASPSSSKKKKNTRAIQPLQTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
Amino Acid Sequences MTLRSSPSKLLLTLTYNCHASPSSSKKKKNTRAIQPLQTIAPGQTPMGMPVPLSFNSIPLDASQYICPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.26
5 0.24
6 0.22
7 0.2
8 0.25
9 0.3
10 0.39
11 0.46
12 0.53
13 0.61
14 0.71
15 0.79
16 0.81
17 0.81
18 0.8
19 0.83
20 0.83
21 0.8
22 0.71
23 0.62
24 0.51
25 0.43
26 0.32
27 0.22
28 0.16
29 0.1
30 0.08
31 0.08
32 0.08
33 0.09
34 0.1
35 0.09
36 0.08
37 0.09
38 0.12
39 0.12
40 0.16
41 0.14
42 0.14
43 0.16
44 0.16
45 0.16
46 0.13
47 0.18
48 0.14
49 0.17
50 0.16