Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165IBH0

Protein Details
Accession A0A165IBH0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-57HLDSNDTKEKRQKNKRQKKRVRNKKRKKRRQKKKECKNGPGFMQHBasic
NLS Segment(s)
PositionSequence
20-46KEKRQKNKRQKKRVRNKKRKKRRQKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MANIRPCKHVNMHLDSNDTKEKRQKNKRQKKRVRNKKRKKRRQKKKECKNGPGFMQHSNSMLTVTVALQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.46
4 0.47
5 0.4
6 0.37
7 0.39
8 0.46
9 0.52
10 0.62
11 0.69
12 0.72
13 0.82
14 0.89
15 0.92
16 0.94
17 0.95
18 0.95
19 0.96
20 0.96
21 0.96
22 0.96
23 0.96
24 0.97
25 0.97
26 0.97
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.97
33 0.97
34 0.95
35 0.94
36 0.92
37 0.87
38 0.8
39 0.78
40 0.69
41 0.63
42 0.57
43 0.47
44 0.39
45 0.33
46 0.29
47 0.21
48 0.18
49 0.13