Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165AD92

Protein Details
Accession A0A165AD92    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
119-143MSVLPKRKHGHKDKQPIKLKKKTQEBasic
NLS Segment(s)
PositionSequence
124-140KRKHGHKDKQPIKLKKK
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MAPKYTTYTIILEWQKTSQKMMKAITSNKRVLKKLISWKQLNMTAKGTFLNISNPFCIKATSKAISWLSIKVLVRQVTSPVLFLEPLLLSVKHYTKNLDKLQNSISIVISIKIYQIVTMSVLPKRKHGHKDKQPIKLKKKTQEVYIEAAIAKLMKDKYNKGNFIKDTQMVARKMKESKELEEKLAAMDLEAETIRLDSQQQQEWLGKYARSAFLAQAGSINAKHEMSIFNGSIVNQTYMDLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.35
4 0.4
5 0.38
6 0.38
7 0.42
8 0.44
9 0.46
10 0.47
11 0.55
12 0.58
13 0.6
14 0.62
15 0.63
16 0.66
17 0.62
18 0.6
19 0.58
20 0.57
21 0.61
22 0.63
23 0.65
24 0.62
25 0.63
26 0.64
27 0.64
28 0.59
29 0.52
30 0.46
31 0.37
32 0.35
33 0.31
34 0.26
35 0.19
36 0.16
37 0.19
38 0.19
39 0.21
40 0.22
41 0.22
42 0.22
43 0.22
44 0.23
45 0.19
46 0.2
47 0.25
48 0.25
49 0.24
50 0.29
51 0.29
52 0.31
53 0.3
54 0.26
55 0.21
56 0.24
57 0.24
58 0.21
59 0.25
60 0.24
61 0.23
62 0.22
63 0.23
64 0.21
65 0.21
66 0.18
67 0.14
68 0.13
69 0.12
70 0.11
71 0.1
72 0.07
73 0.08
74 0.09
75 0.08
76 0.08
77 0.12
78 0.14
79 0.15
80 0.16
81 0.18
82 0.21
83 0.3
84 0.35
85 0.4
86 0.38
87 0.38
88 0.4
89 0.4
90 0.36
91 0.29
92 0.22
93 0.16
94 0.15
95 0.13
96 0.11
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.05
104 0.06
105 0.07
106 0.09
107 0.1
108 0.16
109 0.16
110 0.21
111 0.25
112 0.31
113 0.4
114 0.48
115 0.56
116 0.61
117 0.72
118 0.75
119 0.81
120 0.84
121 0.84
122 0.84
123 0.83
124 0.8
125 0.78
126 0.8
127 0.72
128 0.68
129 0.66
130 0.59
131 0.54
132 0.47
133 0.39
134 0.29
135 0.26
136 0.2
137 0.12
138 0.09
139 0.09
140 0.1
141 0.13
142 0.16
143 0.21
144 0.31
145 0.38
146 0.45
147 0.45
148 0.51
149 0.49
150 0.49
151 0.49
152 0.41
153 0.36
154 0.33
155 0.37
156 0.32
157 0.33
158 0.32
159 0.33
160 0.35
161 0.35
162 0.39
163 0.36
164 0.39
165 0.46
166 0.45
167 0.43
168 0.4
169 0.38
170 0.3
171 0.28
172 0.22
173 0.11
174 0.1
175 0.08
176 0.08
177 0.08
178 0.07
179 0.06
180 0.07
181 0.07
182 0.06
183 0.08
184 0.13
185 0.17
186 0.21
187 0.22
188 0.25
189 0.29
190 0.3
191 0.33
192 0.29
193 0.25
194 0.23
195 0.27
196 0.26
197 0.25
198 0.25
199 0.21
200 0.24
201 0.25
202 0.22
203 0.19
204 0.18
205 0.18
206 0.17
207 0.18
208 0.15
209 0.14
210 0.14
211 0.14
212 0.14
213 0.16
214 0.21
215 0.19
216 0.18
217 0.19
218 0.19
219 0.21
220 0.22
221 0.2
222 0.15
223 0.15