Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A164ZS19

Protein Details
Accession A0A164ZS19    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKKSNKKSNKKTASKTASNTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MPKKSNKKSNKKTASKTASNTTPAPSEQPAGTTATVQSTTTSAPSQQQSGTATTVPPAAPSAAPPAEICTAKPSTWTTEKLRDERDRAILELTLPFLAPVLLTTSRKHCCCCGLSRKQVRRLEKQEAIHSNQSPPSPPLPPLPPPPSGCSYLACEVPESAFYIPQGIIEAAGSLVNLLPPYPPPTDPIKVKRLIDNCEKVISHYKTLAKKRVVIAIKNYKKFEELVRKDEAGTTEADAAKQALRLNVTANYCLKEADKARRRAANYVDKLEYLQSLSLEDPPEQNGEGSSGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.82
4 0.79
5 0.74
6 0.68
7 0.61
8 0.53
9 0.46
10 0.39
11 0.38
12 0.31
13 0.28
14 0.24
15 0.23
16 0.22
17 0.21
18 0.2
19 0.17
20 0.16
21 0.16
22 0.16
23 0.15
24 0.14
25 0.13
26 0.13
27 0.14
28 0.15
29 0.14
30 0.18
31 0.2
32 0.22
33 0.21
34 0.22
35 0.23
36 0.24
37 0.24
38 0.19
39 0.17
40 0.16
41 0.18
42 0.15
43 0.13
44 0.12
45 0.11
46 0.1
47 0.11
48 0.16
49 0.14
50 0.15
51 0.15
52 0.17
53 0.19
54 0.19
55 0.18
56 0.18
57 0.2
58 0.19
59 0.22
60 0.21
61 0.23
62 0.27
63 0.32
64 0.33
65 0.4
66 0.46
67 0.48
68 0.55
69 0.55
70 0.55
71 0.53
72 0.54
73 0.46
74 0.4
75 0.36
76 0.28
77 0.23
78 0.19
79 0.16
80 0.1
81 0.09
82 0.08
83 0.06
84 0.06
85 0.05
86 0.04
87 0.07
88 0.09
89 0.11
90 0.13
91 0.19
92 0.24
93 0.26
94 0.28
95 0.26
96 0.28
97 0.3
98 0.36
99 0.4
100 0.44
101 0.53
102 0.62
103 0.68
104 0.72
105 0.76
106 0.75
107 0.75
108 0.73
109 0.71
110 0.67
111 0.62
112 0.6
113 0.57
114 0.55
115 0.49
116 0.43
117 0.37
118 0.33
119 0.31
120 0.25
121 0.22
122 0.2
123 0.17
124 0.18
125 0.19
126 0.2
127 0.23
128 0.28
129 0.3
130 0.31
131 0.31
132 0.33
133 0.32
134 0.32
135 0.3
136 0.24
137 0.23
138 0.21
139 0.2
140 0.17
141 0.15
142 0.12
143 0.11
144 0.1
145 0.09
146 0.07
147 0.07
148 0.06
149 0.07
150 0.07
151 0.07
152 0.07
153 0.05
154 0.05
155 0.05
156 0.05
157 0.04
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.05
167 0.09
168 0.11
169 0.11
170 0.14
171 0.2
172 0.25
173 0.31
174 0.36
175 0.39
176 0.42
177 0.43
178 0.46
179 0.46
180 0.46
181 0.49
182 0.48
183 0.43
184 0.41
185 0.4
186 0.36
187 0.41
188 0.38
189 0.31
190 0.31
191 0.36
192 0.41
193 0.49
194 0.54
195 0.48
196 0.5
197 0.5
198 0.53
199 0.52
200 0.47
201 0.5
202 0.53
203 0.58
204 0.59
205 0.59
206 0.51
207 0.48
208 0.46
209 0.45
210 0.45
211 0.42
212 0.41
213 0.44
214 0.43
215 0.42
216 0.43
217 0.36
218 0.26
219 0.21
220 0.17
221 0.17
222 0.17
223 0.16
224 0.14
225 0.14
226 0.13
227 0.14
228 0.15
229 0.13
230 0.14
231 0.15
232 0.17
233 0.21
234 0.22
235 0.24
236 0.25
237 0.24
238 0.23
239 0.24
240 0.22
241 0.24
242 0.29
243 0.36
244 0.43
245 0.49
246 0.56
247 0.61
248 0.64
249 0.64
250 0.67
251 0.67
252 0.64
253 0.62
254 0.57
255 0.51
256 0.49
257 0.43
258 0.35
259 0.26
260 0.2
261 0.14
262 0.14
263 0.15
264 0.17
265 0.17
266 0.18
267 0.17
268 0.18
269 0.2
270 0.19
271 0.18
272 0.15
273 0.15