Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H5A9

Protein Details
Accession A0A165H5A9    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-38SSTAPKPPLKRLTRDQRRDIHydrophilic
NLS Segment(s)
PositionSequence
136-138RPP
143-155SAGKDGAVKKIKK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MTPSPSSATSPPSLPSPPSSTAPKPPLKRLTRDQRRDILLLRKLGHTYEYIATFLKVSPRAVQYTCQKQDATPQHSRAGRRPKLTKEDGDRLEEFVKDAANNKMSYAQVARALWPEGGVGEEAVKHALYQRGYRRRPPAASSSAGKDGAVKKIKKNKDTSTPVQNENA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.31
5 0.33
6 0.39
7 0.39
8 0.46
9 0.52
10 0.56
11 0.55
12 0.61
13 0.67
14 0.66
15 0.69
16 0.71
17 0.74
18 0.76
19 0.8
20 0.78
21 0.75
22 0.73
23 0.68
24 0.63
25 0.61
26 0.55
27 0.51
28 0.45
29 0.4
30 0.37
31 0.34
32 0.3
33 0.22
34 0.2
35 0.17
36 0.16
37 0.15
38 0.15
39 0.14
40 0.13
41 0.13
42 0.14
43 0.14
44 0.14
45 0.16
46 0.18
47 0.21
48 0.21
49 0.26
50 0.29
51 0.38
52 0.39
53 0.38
54 0.36
55 0.33
56 0.41
57 0.44
58 0.44
59 0.4
60 0.4
61 0.43
62 0.46
63 0.48
64 0.47
65 0.49
66 0.48
67 0.49
68 0.52
69 0.52
70 0.56
71 0.58
72 0.55
73 0.51
74 0.53
75 0.49
76 0.47
77 0.42
78 0.36
79 0.33
80 0.28
81 0.21
82 0.14
83 0.13
84 0.09
85 0.11
86 0.12
87 0.13
88 0.13
89 0.13
90 0.16
91 0.15
92 0.16
93 0.15
94 0.14
95 0.15
96 0.15
97 0.16
98 0.15
99 0.16
100 0.14
101 0.13
102 0.11
103 0.08
104 0.08
105 0.07
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.05
113 0.08
114 0.12
115 0.14
116 0.21
117 0.31
118 0.4
119 0.46
120 0.54
121 0.59
122 0.62
123 0.65
124 0.63
125 0.61
126 0.56
127 0.56
128 0.51
129 0.48
130 0.45
131 0.41
132 0.35
133 0.33
134 0.31
135 0.35
136 0.4
137 0.39
138 0.44
139 0.54
140 0.63
141 0.67
142 0.72
143 0.72
144 0.74
145 0.79
146 0.77
147 0.78
148 0.75