Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165G9S8

Protein Details
Accession A0A165G9S8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
172-198AEKEAKMRMKKGRSDKKSARRNKGSDYBasic
NLS Segment(s)
PositionSequence
166-194VKGLKQAEKEAKMRMKKGRSDKKSARRNK
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MMLRHLAGARSLLPKIHRNSFVGSLTCRRLASNTNRSGSLDEAELAAARRWIANCTPDSIPKNLGQVSFSRSSGPGGQNVNKVNSKATLRLSLDALYNWVPRPLRASIKDSRYYAPNSNSLIIQADDTRSQAKNANQCFGRLHELILQAARNTIPGETSDEQRERVKGLKQAEKEAKMRMKKGRSDKKSARRNKGSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.44
4 0.44
5 0.43
6 0.46
7 0.48
8 0.47
9 0.42
10 0.4
11 0.38
12 0.38
13 0.38
14 0.34
15 0.3
16 0.29
17 0.34
18 0.4
19 0.44
20 0.48
21 0.47
22 0.48
23 0.48
24 0.47
25 0.4
26 0.31
27 0.22
28 0.15
29 0.13
30 0.12
31 0.11
32 0.1
33 0.09
34 0.08
35 0.07
36 0.09
37 0.09
38 0.12
39 0.14
40 0.17
41 0.18
42 0.21
43 0.23
44 0.28
45 0.3
46 0.29
47 0.29
48 0.27
49 0.29
50 0.27
51 0.25
52 0.2
53 0.19
54 0.22
55 0.22
56 0.2
57 0.18
58 0.17
59 0.18
60 0.21
61 0.21
62 0.2
63 0.21
64 0.24
65 0.27
66 0.28
67 0.3
68 0.27
69 0.27
70 0.23
71 0.23
72 0.22
73 0.2
74 0.2
75 0.22
76 0.21
77 0.22
78 0.22
79 0.19
80 0.18
81 0.15
82 0.15
83 0.11
84 0.11
85 0.1
86 0.12
87 0.11
88 0.1
89 0.14
90 0.15
91 0.2
92 0.22
93 0.27
94 0.31
95 0.36
96 0.4
97 0.38
98 0.37
99 0.35
100 0.36
101 0.35
102 0.31
103 0.3
104 0.27
105 0.26
106 0.25
107 0.22
108 0.19
109 0.15
110 0.13
111 0.1
112 0.09
113 0.09
114 0.1
115 0.13
116 0.12
117 0.13
118 0.18
119 0.21
120 0.28
121 0.29
122 0.35
123 0.32
124 0.33
125 0.33
126 0.31
127 0.33
128 0.25
129 0.24
130 0.22
131 0.22
132 0.22
133 0.22
134 0.19
135 0.14
136 0.15
137 0.13
138 0.1
139 0.1
140 0.09
141 0.08
142 0.08
143 0.16
144 0.16
145 0.2
146 0.26
147 0.27
148 0.29
149 0.32
150 0.32
151 0.27
152 0.3
153 0.32
154 0.32
155 0.38
156 0.44
157 0.44
158 0.53
159 0.59
160 0.6
161 0.58
162 0.61
163 0.61
164 0.6
165 0.65
166 0.64
167 0.64
168 0.67
169 0.75
170 0.78
171 0.77
172 0.81
173 0.84
174 0.85
175 0.87
176 0.89
177 0.89
178 0.88