Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IRZ3

Protein Details
Accession A0A165IRZ3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-33VPTSADPRSKRPTKRRVMTPSSAQAHydrophilic
120-149KDDAKTSKNKARREKQKARKTKGKTEPAKGBasic
NLS Segment(s)
PositionSequence
118-149KAKDDAKTSKNKARREKQKARKTKGKTEPAKG
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESVPTSADPRSKRPTKRRVMTPSSAQASSVEALFAKPDREITVPGGPKPKTLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRMMDDEVKREKGNEDFERQREEMKAKDDAKTSKNKARREKQKARKTKGKTEPAKGSDSSARAKANGVSGLPAAETITAESPASGAHLASTSDNPNPEEIGIIIHDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.45
4 0.53
5 0.62
6 0.69
7 0.74
8 0.79
9 0.84
10 0.87
11 0.87
12 0.86
13 0.83
14 0.8
15 0.78
16 0.71
17 0.62
18 0.52
19 0.42
20 0.36
21 0.29
22 0.21
23 0.13
24 0.09
25 0.09
26 0.1
27 0.11
28 0.09
29 0.09
30 0.1
31 0.13
32 0.14
33 0.16
34 0.18
35 0.25
36 0.26
37 0.29
38 0.35
39 0.32
40 0.32
41 0.33
42 0.34
43 0.31
44 0.35
45 0.4
46 0.35
47 0.38
48 0.38
49 0.37
50 0.33
51 0.28
52 0.25
53 0.18
54 0.15
55 0.11
56 0.1
57 0.07
58 0.07
59 0.07
60 0.04
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.07
69 0.07
70 0.12
71 0.2
72 0.27
73 0.31
74 0.35
75 0.42
76 0.5
77 0.57
78 0.62
79 0.62
80 0.57
81 0.53
82 0.5
83 0.46
84 0.42
85 0.36
86 0.32
87 0.26
88 0.25
89 0.23
90 0.23
91 0.22
92 0.2
93 0.26
94 0.24
95 0.28
96 0.31
97 0.32
98 0.37
99 0.36
100 0.34
101 0.29
102 0.28
103 0.25
104 0.23
105 0.29
106 0.25
107 0.28
108 0.3
109 0.32
110 0.34
111 0.4
112 0.43
113 0.44
114 0.5
115 0.56
116 0.62
117 0.68
118 0.75
119 0.77
120 0.83
121 0.86
122 0.89
123 0.91
124 0.9
125 0.89
126 0.86
127 0.85
128 0.85
129 0.84
130 0.81
131 0.79
132 0.79
133 0.73
134 0.7
135 0.59
136 0.53
137 0.47
138 0.42
139 0.38
140 0.32
141 0.3
142 0.26
143 0.27
144 0.25
145 0.23
146 0.22
147 0.18
148 0.15
149 0.15
150 0.14
151 0.13
152 0.11
153 0.08
154 0.07
155 0.06
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.08
162 0.07
163 0.09
164 0.08
165 0.06
166 0.06
167 0.07
168 0.08
169 0.1
170 0.13
171 0.15
172 0.18
173 0.21
174 0.21
175 0.21
176 0.21
177 0.19
178 0.18
179 0.14
180 0.13