Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165FYB4

Protein Details
Accession A0A165FYB4   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-89GSSCKTCKKKTPQGHMYCQPCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019367  PDZ-binding_CRIPT  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF10235  Cript  
Amino Acid Sequences MVCSKCQKLQKTELATPGVKRKSEMYYGSPATSSASSRDKSSSATLGSNGIGKSKLLSKTAKNPMLAYGSSCKTCKKKTPQGHMYCQPCAYKAAACASCGKTEKKKSSGGAPVVQGQKYSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.54
4 0.54
5 0.51
6 0.43
7 0.4
8 0.38
9 0.37
10 0.4
11 0.4
12 0.35
13 0.37
14 0.38
15 0.37
16 0.33
17 0.29
18 0.25
19 0.22
20 0.18
21 0.15
22 0.18
23 0.18
24 0.2
25 0.21
26 0.2
27 0.21
28 0.23
29 0.21
30 0.17
31 0.17
32 0.16
33 0.16
34 0.15
35 0.15
36 0.13
37 0.11
38 0.1
39 0.09
40 0.1
41 0.13
42 0.15
43 0.16
44 0.19
45 0.21
46 0.3
47 0.38
48 0.41
49 0.37
50 0.35
51 0.33
52 0.33
53 0.3
54 0.23
55 0.18
56 0.16
57 0.18
58 0.18
59 0.22
60 0.25
61 0.3
62 0.37
63 0.44
64 0.53
65 0.61
66 0.71
67 0.76
68 0.78
69 0.82
70 0.81
71 0.75
72 0.67
73 0.6
74 0.5
75 0.41
76 0.35
77 0.28
78 0.21
79 0.19
80 0.24
81 0.22
82 0.22
83 0.27
84 0.27
85 0.31
86 0.33
87 0.37
88 0.39
89 0.48
90 0.55
91 0.54
92 0.59
93 0.56
94 0.61
95 0.64
96 0.6
97 0.55
98 0.5
99 0.52
100 0.51
101 0.48
102 0.4