Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A161TE66

Protein Details
Accession A0A161TE66    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-124RQISKGRKKVDSRIRRKERRERERIQNGDQBasic
NLS Segment(s)
PositionSequence
99-117KGRKKVDSRIRRKERRERE
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFASSPVLAAPQCQVLYKVLYYARSELYYRSTTAQPAFSAGVLRALRTLYSVGGALYARDVHGIQPASRSHRTLYSILKLHLTLGAHDVANQVQRQISKGRKKVDSRIRRKERRERERIQNGDQINGQADRQTYRPVTTQSNRQTGRPTEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.18
5 0.2
6 0.18
7 0.21
8 0.22
9 0.23
10 0.23
11 0.23
12 0.24
13 0.21
14 0.24
15 0.23
16 0.23
17 0.24
18 0.23
19 0.24
20 0.25
21 0.25
22 0.2
23 0.2
24 0.19
25 0.16
26 0.16
27 0.12
28 0.17
29 0.15
30 0.15
31 0.13
32 0.13
33 0.13
34 0.13
35 0.13
36 0.07
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.09
50 0.1
51 0.1
52 0.13
53 0.15
54 0.21
55 0.22
56 0.23
57 0.2
58 0.22
59 0.25
60 0.24
61 0.25
62 0.24
63 0.24
64 0.24
65 0.23
66 0.21
67 0.18
68 0.17
69 0.14
70 0.1
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.08
77 0.11
78 0.1
79 0.09
80 0.1
81 0.1
82 0.12
83 0.19
84 0.27
85 0.34
86 0.4
87 0.46
88 0.53
89 0.57
90 0.65
91 0.69
92 0.72
93 0.73
94 0.78
95 0.82
96 0.84
97 0.89
98 0.9
99 0.91
100 0.9
101 0.9
102 0.87
103 0.87
104 0.88
105 0.84
106 0.79
107 0.74
108 0.64
109 0.57
110 0.49
111 0.39
112 0.31
113 0.26
114 0.21
115 0.17
116 0.17
117 0.16
118 0.17
119 0.22
120 0.22
121 0.24
122 0.28
123 0.3
124 0.38
125 0.41
126 0.5
127 0.52
128 0.6
129 0.59
130 0.58
131 0.62