Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IKA5

Protein Details
Accession A0A165IKA5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27NSSQHNQSKKAHKNGIKKPRTHHydrophilic
NLS Segment(s)
PositionSequence
14-60KKAHKNGIKKPRTHRYPSLKGTDPKFRRNHRHALHGTMRALKEAKEG
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHKNGIKKPRTHRYPSLKGTDPKFRRNHRHALHGTMRALKEAKEGKRDTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.8
4 0.77
5 0.79
6 0.8
7 0.83
8 0.8
9 0.78
10 0.79
11 0.8
12 0.8
13 0.76
14 0.76
15 0.74
16 0.76
17 0.74
18 0.7
19 0.65
20 0.62
21 0.59
22 0.6
23 0.54
24 0.54
25 0.57
26 0.6
27 0.64
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.65
34 0.63
35 0.58
36 0.55
37 0.5
38 0.47
39 0.4
40 0.38
41 0.3
42 0.32
43 0.35
44 0.38
45 0.41