Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165JT95

Protein Details
Accession A0A165JT95    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
140-168EEPSEIRNAPKKKSKRPKKAIKLSFDQDDHydrophilic
NLS Segment(s)
PositionSequence
147-160NAPKKKSKRPKKAI
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFNSKNLSYESKEPNFLRRLKSQYVGGDPQKHARSSVVPSRLRNEDEDEEPTYVEEGSNENITKAEYEALTKGENDAKKSTEPAISEDATSSNPSKTETESEARDETPIRSKEIVAGVGGSQKKRKPVKTVGQDDEEEEEPSEIRNAPKKKSKRPKKAIKLSFDQDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.55
4 0.55
5 0.53
6 0.52
7 0.55
8 0.53
9 0.55
10 0.52
11 0.5
12 0.51
13 0.53
14 0.51
15 0.51
16 0.48
17 0.53
18 0.51
19 0.47
20 0.41
21 0.36
22 0.33
23 0.33
24 0.39
25 0.4
26 0.41
27 0.43
28 0.47
29 0.49
30 0.47
31 0.42
32 0.4
33 0.35
34 0.32
35 0.34
36 0.31
37 0.27
38 0.25
39 0.22
40 0.17
41 0.13
42 0.1
43 0.07
44 0.07
45 0.07
46 0.1
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.09
53 0.08
54 0.06
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.13
62 0.15
63 0.16
64 0.17
65 0.17
66 0.17
67 0.19
68 0.19
69 0.17
70 0.16
71 0.16
72 0.18
73 0.17
74 0.16
75 0.15
76 0.14
77 0.12
78 0.13
79 0.12
80 0.09
81 0.09
82 0.11
83 0.11
84 0.12
85 0.14
86 0.16
87 0.19
88 0.2
89 0.22
90 0.22
91 0.21
92 0.21
93 0.19
94 0.17
95 0.22
96 0.22
97 0.22
98 0.22
99 0.22
100 0.24
101 0.24
102 0.23
103 0.15
104 0.14
105 0.11
106 0.16
107 0.18
108 0.18
109 0.21
110 0.23
111 0.32
112 0.4
113 0.45
114 0.48
115 0.55
116 0.64
117 0.69
118 0.76
119 0.72
120 0.69
121 0.64
122 0.57
123 0.51
124 0.41
125 0.32
126 0.23
127 0.18
128 0.14
129 0.14
130 0.14
131 0.12
132 0.16
133 0.24
134 0.28
135 0.36
136 0.46
137 0.55
138 0.65
139 0.74
140 0.81
141 0.83
142 0.9
143 0.93
144 0.94
145 0.96
146 0.94
147 0.91
148 0.89