Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IRB7

Protein Details
Accession A0A165IRB7    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-37SKNTSPLKCLPTPRRAPRKKKPKPAALGGTSTHydrophilic
NLS Segment(s)
PositionSequence
18-30PRRAPRKKKPKPA
108-115AGAKRRRL
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRLRSSKNTSPLKCLPTPRRAPRKKKPKPAALGGTSTPPPTPPPQSPAAAAAAAPPPPPPPKTPSPSPQKAPSSGTPSSSWTGRLWGLLSSVSPIARKRPAEEVAPSAGAKRRRLSPPPAPPAEELTPSAGQNRWHLPPPPAASPSPSPSPRKRRLEVTEETEEISPKRRHLQSPPAEAPSEAASAPIFVQPNKHSKGTYHCDFSSSDEEDEEDETEQAPLYENEREESPRPIVTKYSKGTYHCDWSDSGSDLSDEEETTPVAVREAVNKARLRAERFKPKVPSGLRTLTRYSTSTVASDISPDRKEPPQISNVALGISPNKEPPQTPSFAFDISPTKNQPQPTLPVAFDISPTKNQPQPTLPVAFDISPTKNQPLQTPSVLLDISPNRKEPSPLPTPILDPSAPFEIPDPNWMAHRFGADVVDYIMDNWDAIGMPQLCEQERAYLVLPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.7
4 0.77
5 0.79
6 0.83
7 0.86
8 0.9
9 0.91
10 0.94
11 0.94
12 0.94
13 0.94
14 0.94
15 0.92
16 0.91
17 0.9
18 0.83
19 0.77
20 0.68
21 0.62
22 0.53
23 0.45
24 0.35
25 0.27
26 0.26
27 0.27
28 0.32
29 0.31
30 0.35
31 0.38
32 0.4
33 0.4
34 0.39
35 0.35
36 0.28
37 0.24
38 0.22
39 0.19
40 0.18
41 0.17
42 0.15
43 0.17
44 0.22
45 0.25
46 0.27
47 0.32
48 0.4
49 0.47
50 0.54
51 0.59
52 0.65
53 0.69
54 0.72
55 0.73
56 0.7
57 0.67
58 0.64
59 0.61
60 0.58
61 0.52
62 0.49
63 0.41
64 0.39
65 0.38
66 0.33
67 0.29
68 0.22
69 0.24
70 0.21
71 0.21
72 0.17
73 0.15
74 0.15
75 0.13
76 0.12
77 0.11
78 0.12
79 0.12
80 0.14
81 0.15
82 0.2
83 0.26
84 0.28
85 0.29
86 0.34
87 0.36
88 0.38
89 0.39
90 0.37
91 0.33
92 0.33
93 0.3
94 0.26
95 0.28
96 0.29
97 0.3
98 0.3
99 0.35
100 0.41
101 0.48
102 0.54
103 0.59
104 0.64
105 0.69
106 0.68
107 0.63
108 0.57
109 0.56
110 0.5
111 0.41
112 0.32
113 0.27
114 0.25
115 0.22
116 0.23
117 0.2
118 0.19
119 0.22
120 0.25
121 0.24
122 0.26
123 0.29
124 0.3
125 0.34
126 0.36
127 0.36
128 0.35
129 0.33
130 0.33
131 0.33
132 0.34
133 0.34
134 0.36
135 0.39
136 0.45
137 0.55
138 0.61
139 0.66
140 0.66
141 0.68
142 0.69
143 0.69
144 0.65
145 0.62
146 0.56
147 0.48
148 0.46
149 0.38
150 0.32
151 0.25
152 0.27
153 0.22
154 0.2
155 0.28
156 0.31
157 0.34
158 0.41
159 0.51
160 0.51
161 0.58
162 0.59
163 0.54
164 0.5
165 0.45
166 0.39
167 0.3
168 0.23
169 0.13
170 0.1
171 0.08
172 0.08
173 0.08
174 0.1
175 0.09
176 0.08
177 0.12
178 0.15
179 0.22
180 0.25
181 0.26
182 0.24
183 0.25
184 0.33
185 0.37
186 0.37
187 0.35
188 0.32
189 0.32
190 0.32
191 0.34
192 0.3
193 0.24
194 0.21
195 0.16
196 0.17
197 0.15
198 0.15
199 0.12
200 0.08
201 0.06
202 0.06
203 0.06
204 0.06
205 0.05
206 0.06
207 0.05
208 0.07
209 0.09
210 0.09
211 0.09
212 0.11
213 0.13
214 0.13
215 0.15
216 0.15
217 0.15
218 0.17
219 0.17
220 0.2
221 0.21
222 0.26
223 0.26
224 0.28
225 0.29
226 0.3
227 0.35
228 0.33
229 0.36
230 0.29
231 0.29
232 0.25
233 0.24
234 0.23
235 0.2
236 0.18
237 0.11
238 0.11
239 0.1
240 0.1
241 0.08
242 0.07
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.05
249 0.05
250 0.06
251 0.06
252 0.09
253 0.14
254 0.16
255 0.21
256 0.22
257 0.24
258 0.29
259 0.33
260 0.36
261 0.41
262 0.47
263 0.52
264 0.56
265 0.61
266 0.6
267 0.59
268 0.61
269 0.55
270 0.5
271 0.46
272 0.49
273 0.45
274 0.43
275 0.43
276 0.36
277 0.36
278 0.33
279 0.28
280 0.23
281 0.21
282 0.18
283 0.16
284 0.15
285 0.13
286 0.14
287 0.15
288 0.17
289 0.17
290 0.17
291 0.2
292 0.22
293 0.27
294 0.28
295 0.29
296 0.31
297 0.32
298 0.33
299 0.31
300 0.29
301 0.24
302 0.21
303 0.17
304 0.13
305 0.13
306 0.12
307 0.13
308 0.14
309 0.15
310 0.16
311 0.21
312 0.24
313 0.25
314 0.26
315 0.27
316 0.27
317 0.26
318 0.26
319 0.22
320 0.22
321 0.23
322 0.27
323 0.26
324 0.29
325 0.32
326 0.34
327 0.35
328 0.34
329 0.35
330 0.36
331 0.36
332 0.32
333 0.3
334 0.3
335 0.26
336 0.24
337 0.23
338 0.21
339 0.22
340 0.25
341 0.28
342 0.29
343 0.31
344 0.33
345 0.33
346 0.35
347 0.36
348 0.36
349 0.32
350 0.3
351 0.3
352 0.26
353 0.24
354 0.23
355 0.21
356 0.22
357 0.24
358 0.27
359 0.28
360 0.3
361 0.33
362 0.34
363 0.37
364 0.35
365 0.34
366 0.31
367 0.3
368 0.29
369 0.23
370 0.24
371 0.26
372 0.31
373 0.31
374 0.33
375 0.33
376 0.35
377 0.38
378 0.36
379 0.37
380 0.37
381 0.38
382 0.39
383 0.38
384 0.39
385 0.38
386 0.39
387 0.31
388 0.24
389 0.24
390 0.25
391 0.23
392 0.21
393 0.2
394 0.21
395 0.22
396 0.25
397 0.25
398 0.21
399 0.26
400 0.27
401 0.28
402 0.24
403 0.25
404 0.21
405 0.19
406 0.2
407 0.16
408 0.15
409 0.13
410 0.13
411 0.11
412 0.1
413 0.11
414 0.09
415 0.08
416 0.07
417 0.07
418 0.06
419 0.07
420 0.14
421 0.13
422 0.14
423 0.18
424 0.21
425 0.22
426 0.24
427 0.25
428 0.23
429 0.23
430 0.25