Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165H3U2

Protein Details
Accession A0A165H3U2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
21-43KETPNSRNSKQRKKQPPLPWSLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MRGFAASTIPSVSFSTTQKDKETPNSRNSKQRKKQPPLPWSLTPRGGGTTSTPQTRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.23
4 0.25
5 0.26
6 0.29
7 0.3
8 0.37
9 0.45
10 0.44
11 0.49
12 0.56
13 0.56
14 0.63
15 0.69
16 0.7
17 0.7
18 0.75
19 0.77
20 0.77
21 0.84
22 0.84
23 0.83
24 0.81
25 0.79
26 0.76
27 0.72
28 0.68
29 0.62
30 0.53
31 0.45
32 0.39
33 0.33
34 0.27
35 0.25
36 0.28
37 0.3
38 0.32