Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5QYI4

Protein Details
Accession E5QYI4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKGDNKRQQRQKKQKDEEVPGTSHydrophilic
65-91LPSSTYRQQRHQPARSRDRFKRSPLDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKGDNKRQQRQKKQKDEEVPGTSASGPPRPYRYAISPPIWGSVDFLTLAPPVVRHGGGSGSEQVLPSSTYRQQRHQPARSRDRFKRSPLDPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.86
5 0.79
6 0.69
7 0.58
8 0.5
9 0.4
10 0.33
11 0.26
12 0.22
13 0.19
14 0.21
15 0.25
16 0.26
17 0.28
18 0.29
19 0.32
20 0.36
21 0.39
22 0.38
23 0.36
24 0.35
25 0.35
26 0.31
27 0.26
28 0.2
29 0.14
30 0.12
31 0.1
32 0.09
33 0.07
34 0.07
35 0.07
36 0.05
37 0.05
38 0.06
39 0.07
40 0.07
41 0.06
42 0.07
43 0.08
44 0.08
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.1
53 0.09
54 0.13
55 0.18
56 0.26
57 0.3
58 0.37
59 0.45
60 0.55
61 0.64
62 0.69
63 0.73
64 0.75
65 0.83
66 0.87
67 0.88
68 0.86
69 0.86
70 0.84
71 0.82
72 0.81