Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4V4Z0

Protein Details
Accession E4V4Z0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-63RSTARPNRSPSKRQAARKRQPLAPHydrophilic
NLS Segment(s)
PositionSequence
44-58RPNRSPSKRQAARKR
134-147LIKRNPSAPKPRIA
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
Amino Acid Sequences MPWKAEPPCPVLRLSMLQTRRLPLPLPCLPPRPAERTTSRSTARPNRSPSKRQAARKRQPLAPTSVPARGPCPDKTPAPASAPVPVPAPTPSPTPDSAPEALPVAKKTEPRSLSRTSTAPPNLQLQPQAQARKLIKRNPSAPKPRIASRHTKTARSMSLVGAPPPLPTSDPSSPPPLPRAMSVHIPSRTASPVATGQGADRSKKPRLNSLWSGLFRLRVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.34
4 0.39
5 0.41
6 0.42
7 0.42
8 0.4
9 0.37
10 0.33
11 0.38
12 0.38
13 0.42
14 0.44
15 0.46
16 0.46
17 0.51
18 0.53
19 0.51
20 0.47
21 0.46
22 0.48
23 0.49
24 0.53
25 0.53
26 0.5
27 0.48
28 0.55
29 0.58
30 0.61
31 0.62
32 0.65
33 0.68
34 0.74
35 0.77
36 0.77
37 0.78
38 0.77
39 0.79
40 0.82
41 0.83
42 0.84
43 0.87
44 0.84
45 0.78
46 0.76
47 0.7
48 0.66
49 0.58
50 0.52
51 0.45
52 0.42
53 0.38
54 0.33
55 0.31
56 0.27
57 0.27
58 0.25
59 0.27
60 0.27
61 0.27
62 0.3
63 0.31
64 0.3
65 0.3
66 0.3
67 0.26
68 0.27
69 0.26
70 0.23
71 0.21
72 0.18
73 0.16
74 0.14
75 0.16
76 0.13
77 0.14
78 0.15
79 0.17
80 0.18
81 0.19
82 0.19
83 0.21
84 0.2
85 0.19
86 0.17
87 0.15
88 0.15
89 0.14
90 0.13
91 0.12
92 0.13
93 0.16
94 0.19
95 0.25
96 0.27
97 0.3
98 0.35
99 0.36
100 0.37
101 0.36
102 0.34
103 0.28
104 0.32
105 0.31
106 0.27
107 0.24
108 0.26
109 0.25
110 0.24
111 0.25
112 0.19
113 0.22
114 0.26
115 0.27
116 0.23
117 0.29
118 0.3
119 0.37
120 0.42
121 0.43
122 0.46
123 0.5
124 0.57
125 0.6
126 0.67
127 0.69
128 0.66
129 0.66
130 0.63
131 0.62
132 0.62
133 0.57
134 0.58
135 0.52
136 0.59
137 0.56
138 0.55
139 0.53
140 0.52
141 0.49
142 0.43
143 0.41
144 0.31
145 0.34
146 0.31
147 0.28
148 0.24
149 0.21
150 0.18
151 0.17
152 0.17
153 0.12
154 0.12
155 0.19
156 0.21
157 0.25
158 0.27
159 0.33
160 0.35
161 0.36
162 0.37
163 0.34
164 0.31
165 0.3
166 0.32
167 0.28
168 0.33
169 0.34
170 0.39
171 0.36
172 0.36
173 0.34
174 0.32
175 0.31
176 0.25
177 0.22
178 0.17
179 0.18
180 0.19
181 0.19
182 0.17
183 0.15
184 0.22
185 0.25
186 0.25
187 0.29
188 0.33
189 0.41
190 0.45
191 0.48
192 0.51
193 0.55
194 0.61
195 0.62
196 0.64
197 0.65
198 0.61
199 0.62
200 0.54
201 0.51