Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V3W9

Protein Details
Accession E4V3W9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-38RPNLSHSSWKNEREKRKQKANSKERNTSVHydrophilic
NLS Segment(s)
PositionSequence
24-28KRKQK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MPKPCSDRVRPNLSHSSWKNEREKRKQKANSKERNTSVPQVQSNQMSSLALPNASKEWFLLPVKSKFKEYEEPTEHVRRADQPTNLPVACGVHIHGTMPTFAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.59
3 0.6
4 0.57
5 0.62
6 0.65
7 0.65
8 0.72
9 0.73
10 0.81
11 0.81
12 0.85
13 0.86
14 0.86
15 0.89
16 0.89
17 0.89
18 0.86
19 0.85
20 0.77
21 0.74
22 0.68
23 0.62
24 0.55
25 0.5
26 0.43
27 0.37
28 0.37
29 0.32
30 0.29
31 0.24
32 0.2
33 0.15
34 0.13
35 0.11
36 0.09
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.07
44 0.07
45 0.11
46 0.11
47 0.14
48 0.18
49 0.25
50 0.31
51 0.32
52 0.34
53 0.32
54 0.36
55 0.42
56 0.42
57 0.44
58 0.44
59 0.45
60 0.48
61 0.52
62 0.48
63 0.4
64 0.38
65 0.33
66 0.36
67 0.4
68 0.37
69 0.36
70 0.39
71 0.44
72 0.41
73 0.35
74 0.29
75 0.24
76 0.21
77 0.17
78 0.15
79 0.12
80 0.13
81 0.13
82 0.14
83 0.13