Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4V274

Protein Details
Accession E4V274    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRRRSRKKKKKKVDAQWTGSGGBasic
NLS Segment(s)
PositionSequence
2-12RRRSRKKKKKK
79-82RKKA
Subcellular Location(s) mito 17.5, mito_nucl 12, nucl 5.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MRRRSRKKKKKKVDAQWTGSGGGGSVRGRRALLSIDARWCAEVMMLEAQPWRYRGDVSGVRRSEMRHAPGWSGAGNASRKKAKGEQGGGWRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.91
3 0.86
4 0.76
5 0.66
6 0.55
7 0.43
8 0.31
9 0.21
10 0.17
11 0.11
12 0.12
13 0.12
14 0.12
15 0.13
16 0.13
17 0.14
18 0.13
19 0.16
20 0.18
21 0.19
22 0.2
23 0.21
24 0.21
25 0.2
26 0.18
27 0.13
28 0.09
29 0.07
30 0.06
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.09
37 0.1
38 0.1
39 0.08
40 0.09
41 0.1
42 0.16
43 0.22
44 0.26
45 0.34
46 0.33
47 0.33
48 0.34
49 0.35
50 0.36
51 0.35
52 0.34
53 0.3
54 0.31
55 0.32
56 0.32
57 0.32
58 0.25
59 0.2
60 0.17
61 0.18
62 0.22
63 0.23
64 0.27
65 0.31
66 0.32
67 0.37
68 0.43
69 0.47
70 0.51
71 0.54
72 0.56