Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UZG3

Protein Details
Accession E4UZG3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-85YIETNEKKAKKKKREQRKIGFRDRYTBasic
NLS Segment(s)
PositionSequence
66-78KKAKKKKREQRKI
Subcellular Location(s) nucl 15.5, cyto_nucl 12.833, cyto 7, cyto_mito 4.499
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDDPGLVTSFGPFSEYLPSSQPEPSHGSNADRRLAVLGDTEIANYAGFLSLMSWLGAYTYIETNEKKAKKKKREQRKIGFRDRYTGNILPEDPSFLFVSKGNRSFVPARTDGRDRNPAPVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.19
5 0.2
6 0.2
7 0.23
8 0.22
9 0.2
10 0.25
11 0.25
12 0.27
13 0.27
14 0.3
15 0.33
16 0.37
17 0.36
18 0.3
19 0.28
20 0.25
21 0.23
22 0.19
23 0.14
24 0.1
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.06
48 0.08
49 0.08
50 0.11
51 0.18
52 0.22
53 0.29
54 0.37
55 0.47
56 0.56
57 0.67
58 0.74
59 0.79
60 0.86
61 0.89
62 0.91
63 0.92
64 0.91
65 0.91
66 0.9
67 0.79
68 0.74
69 0.65
70 0.58
71 0.53
72 0.46
73 0.37
74 0.3
75 0.3
76 0.26
77 0.24
78 0.23
79 0.17
80 0.16
81 0.16
82 0.14
83 0.14
84 0.15
85 0.21
86 0.24
87 0.27
88 0.27
89 0.27
90 0.32
91 0.34
92 0.37
93 0.38
94 0.36
95 0.37
96 0.41
97 0.48
98 0.48
99 0.52
100 0.57
101 0.51