Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166SPU4

Protein Details
Accession A0A166SPU4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-63VDAERRRKRRMGRIRSAQHRKQRDTBasic
NLS Segment(s)
PositionSequence
42-59ERRRKRRMGRIRSAQHRK
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSNDGDWLYLSPLRLCSIRGVVLETWGVGSWRRKGEYGVDAERRRKRRMGRIRSAQHRKQRDTDDKLVNSKASTHTKGGRSLKCKGMSGRAGEAIYDRITDPRGATVRLGVPHAKTPHWCGSGRVGGEAADSEVPLSMSMLYSGHVRLGQIPRVFAAVTLHPDLRSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.2
5 0.21
6 0.2
7 0.22
8 0.2
9 0.21
10 0.2
11 0.16
12 0.14
13 0.11
14 0.11
15 0.12
16 0.16
17 0.2
18 0.25
19 0.27
20 0.27
21 0.28
22 0.33
23 0.35
24 0.37
25 0.39
26 0.43
27 0.46
28 0.54
29 0.61
30 0.61
31 0.6
32 0.61
33 0.62
34 0.64
35 0.7
36 0.72
37 0.74
38 0.79
39 0.83
40 0.87
41 0.89
42 0.86
43 0.84
44 0.82
45 0.76
46 0.72
47 0.73
48 0.71
49 0.69
50 0.69
51 0.67
52 0.6
53 0.59
54 0.54
55 0.45
56 0.35
57 0.29
58 0.27
59 0.24
60 0.24
61 0.24
62 0.28
63 0.3
64 0.37
65 0.43
66 0.43
67 0.42
68 0.43
69 0.46
70 0.43
71 0.43
72 0.37
73 0.36
74 0.33
75 0.31
76 0.28
77 0.24
78 0.22
79 0.2
80 0.19
81 0.14
82 0.11
83 0.1
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.12
90 0.13
91 0.13
92 0.13
93 0.14
94 0.16
95 0.16
96 0.18
97 0.16
98 0.16
99 0.21
100 0.23
101 0.23
102 0.22
103 0.27
104 0.32
105 0.34
106 0.33
107 0.3
108 0.34
109 0.37
110 0.35
111 0.29
112 0.22
113 0.19
114 0.19
115 0.17
116 0.12
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.07
130 0.08
131 0.09
132 0.09
133 0.1
134 0.16
135 0.21
136 0.27
137 0.27
138 0.28
139 0.27
140 0.28
141 0.27
142 0.21
143 0.2
144 0.16
145 0.2
146 0.22
147 0.23