FuNGI

A0A166RSG6

Protein Details

Accession

A0A166RSG6

Localization Confidence

Medium

Confidence Score

11.3

NoLS Segment(s)

Position	Sequence	Protein Nature
42-69	LSLAKPTPTRQPQQQRVNRSPRSKPAVA	Hydrophilic

NLS Segment(s)

Position	Sequence
219-221	ARR

Subcellular Location(s)

mito_nucl 12.166, nucl 12, mito 12

Family & Domain DBs

Amino Acid Sequences

MMLVQKPPSFPSTFSTHNIHHKRNPSAPVVVLPTRTPGLLSLSLAKPTPTRQPQQQRVNRSPRSKPAVAHNRSPKPAAAEAQQLSSEAEAQRKTQQQQPTPAPTPDRHVRAQSVASKAPKDKMNRQVAISTPLSSCSLTGCWVHRSPPLPHTAQGRRNNVRQPSPPNPPSQAEDQTFTEKAKYNSFDPFFVNSSESESDRPAAAQAKAPKLATPSGKLARRRQAPHAGPATPTPAHARAIPMPRTSDQPNRGRHGRTHSAMMNLSRSAPITASSNAYGAFPVCDDSNDAEELTPPATPVEARQELSTQMFDNGPRTAPLSSAYGGYSFAALPSPMASPTLQRQRQHVRSPSEGVFNMSFDEDLSFSSSSDSASEELKMLFGLMPKRPAPGPRGKVHHSANSPSMSAAKAAKEALYASSLFQNSPSPDELPPPAF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.4
3	0.41
4	0.49
5	0.56
6	0.6
7	0.61
8	0.65
9	0.69
10	0.7
11	0.71
12	0.65
13	0.6
14	0.54
15	0.5
16	0.48
17	0.43
18	0.37
19	0.32
20	0.3
21	0.27
22	0.25
23	0.21
24	0.16
25	0.19
26	0.18
27	0.19
28	0.22
29	0.23
30	0.25
31	0.25
32	0.25
33	0.22
34	0.24
35	0.33
36	0.35
37	0.4
38	0.49
39	0.6
40	0.68
41	0.77
42	0.82
43	0.81
44	0.83
45	0.87
46	0.86
47	0.84
48	0.81
49	0.8
50	0.81
51	0.74
52	0.67
53	0.68
54	0.69
55	0.66
56	0.68
57	0.68
58	0.67
59	0.67
60	0.66
61	0.56
62	0.51
63	0.5
64	0.43
65	0.36
66	0.36
67	0.34
68	0.33
69	0.31
70	0.26
71	0.23
72	0.2
73	0.2
74	0.13
75	0.17
76	0.16
77	0.19
78	0.25
79	0.31
80	0.34
81	0.37
82	0.44
83	0.47
84	0.55
85	0.6
86	0.62
87	0.6
88	0.61
89	0.59
90	0.51
91	0.52
92	0.51
93	0.48
94	0.43
95	0.42
96	0.41
97	0.39
98	0.44
99	0.41
100	0.39
101	0.39
102	0.39
103	0.4
104	0.4
105	0.42
106	0.42
107	0.43
108	0.47
109	0.52
110	0.58
111	0.56
112	0.55
113	0.54
114	0.49
115	0.48
116	0.4
117	0.32
118	0.23
119	0.22
120	0.21
121	0.18
122	0.16
123	0.12
124	0.11
125	0.11
126	0.13
127	0.14
128	0.17
129	0.18
130	0.2
131	0.23
132	0.27
133	0.29
134	0.31
135	0.35
136	0.31
137	0.33
138	0.4
139	0.44
140	0.49
141	0.54
142	0.59
143	0.58
144	0.62
145	0.66
146	0.63
147	0.61
148	0.58
149	0.58
150	0.56
151	0.6
152	0.58
153	0.55
154	0.53
155	0.49
156	0.46
157	0.42
158	0.41
159	0.32
160	0.32
161	0.3
162	0.3
163	0.28
164	0.25
165	0.23
166	0.21
167	0.22
168	0.23
169	0.24
170	0.22
171	0.28
172	0.29
173	0.28
174	0.26
175	0.27
176	0.23
177	0.22
178	0.21
179	0.14
180	0.16
181	0.16
182	0.15
183	0.14
184	0.13
185	0.13
186	0.12
187	0.12
188	0.1
189	0.12
190	0.11
191	0.14
192	0.18
193	0.2
194	0.22
195	0.22
196	0.21
197	0.2
198	0.23
199	0.21
200	0.19
201	0.22
202	0.26
203	0.31
204	0.36
205	0.4
206	0.45
207	0.51
208	0.51
209	0.52
210	0.56
211	0.53
212	0.55
213	0.52
214	0.44
215	0.38
216	0.35
217	0.33
218	0.23
219	0.22
220	0.18
221	0.16
222	0.16
223	0.16
224	0.17
225	0.19
226	0.25
227	0.27
228	0.25
229	0.27
230	0.27
231	0.3
232	0.32
233	0.34
234	0.36
235	0.41
236	0.45
237	0.48
238	0.52
239	0.51
240	0.5
241	0.51
242	0.5
243	0.44
244	0.43
245	0.39
246	0.37
247	0.36
248	0.33
249	0.27
250	0.2
251	0.19
252	0.15
253	0.14
254	0.11
255	0.1
256	0.09
257	0.1
258	0.11
259	0.12
260	0.12
261	0.12
262	0.12
263	0.12
264	0.11
265	0.08
266	0.07
267	0.06
268	0.06
269	0.06
270	0.06
271	0.08
272	0.09
273	0.1
274	0.11
275	0.11
276	0.1
277	0.1
278	0.11
279	0.1
280	0.08
281	0.06
282	0.06
283	0.06
284	0.06
285	0.07
286	0.15
287	0.17
288	0.17
289	0.18
290	0.19
291	0.21
292	0.22
293	0.21
294	0.14
295	0.13
296	0.14
297	0.14
298	0.15
299	0.15
300	0.14
301	0.13
302	0.14
303	0.13
304	0.12
305	0.13
306	0.13
307	0.13
308	0.13
309	0.13
310	0.11
311	0.12
312	0.11
313	0.1
314	0.08
315	0.07
316	0.07
317	0.06
318	0.06
319	0.07
320	0.08
321	0.07
322	0.09
323	0.09
324	0.11
325	0.2
326	0.3
327	0.35
328	0.36
329	0.45
330	0.54
331	0.62
332	0.68
333	0.68
334	0.64
335	0.63
336	0.67
337	0.61
338	0.56
339	0.48
340	0.43
341	0.35
342	0.29
343	0.25
344	0.2
345	0.17
346	0.12
347	0.12
348	0.09
349	0.09
350	0.11
351	0.1
352	0.1
353	0.12
354	0.12
355	0.11
356	0.11
357	0.12
358	0.1
359	0.11
360	0.11
361	0.11
362	0.11
363	0.11
364	0.1
365	0.09
366	0.1
367	0.12
368	0.17
369	0.19
370	0.25
371	0.26
372	0.29
373	0.31
374	0.35
375	0.39
376	0.44
377	0.48
378	0.51
379	0.58
380	0.6
381	0.66
382	0.67
383	0.67
384	0.62
385	0.6
386	0.57
387	0.52
388	0.48
389	0.4
390	0.36
391	0.28
392	0.25
393	0.23
394	0.19
395	0.19
396	0.19
397	0.19
398	0.18
399	0.18
400	0.17
401	0.16
402	0.15
403	0.14
404	0.19
405	0.2
406	0.19
407	0.19
408	0.23
409	0.23
410	0.27
411	0.28
412	0.25
413	0.25
414	0.3

A0A166RSG6

3D AlphaFold-predicted Structure Viewer