Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4V481

Protein Details
Accession E4V481   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-29SPLIEPKPSRLKPFKNRDGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036265  HIT-like_sf  
IPR032566  Znf-C2HE  
Pfam View protein in Pfam  
PF16278  zf-C2HE  
Amino Acid Sequences MTSRPKRAASPLIEPKPSRLKPFKNRDGLGAYIKSPESFSATTVISHSPEFVVIHDLYPKSAVHLLILPRDPKKFFQHPFKAFEDADFLESHYNSFSTPFFVELDAFPLAEDDERRHPDREGYLKSDLKCWRCGQNYGSKFAQLKAHLEDEFEEWKRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.63
4 0.61
5 0.6
6 0.59
7 0.63
8 0.67
9 0.77
10 0.8
11 0.79
12 0.76
13 0.72
14 0.66
15 0.59
16 0.54
17 0.45
18 0.35
19 0.28
20 0.28
21 0.23
22 0.2
23 0.17
24 0.16
25 0.15
26 0.15
27 0.15
28 0.15
29 0.15
30 0.16
31 0.16
32 0.13
33 0.12
34 0.12
35 0.09
36 0.1
37 0.1
38 0.09
39 0.11
40 0.1
41 0.11
42 0.13
43 0.13
44 0.12
45 0.14
46 0.13
47 0.11
48 0.12
49 0.12
50 0.09
51 0.12
52 0.13
53 0.15
54 0.17
55 0.18
56 0.19
57 0.21
58 0.22
59 0.23
60 0.29
61 0.34
62 0.38
63 0.45
64 0.52
65 0.54
66 0.57
67 0.56
68 0.52
69 0.44
70 0.39
71 0.32
72 0.23
73 0.2
74 0.15
75 0.13
76 0.11
77 0.11
78 0.11
79 0.08
80 0.07
81 0.06
82 0.07
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.1
89 0.11
90 0.09
91 0.12
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.16
101 0.21
102 0.24
103 0.25
104 0.26
105 0.29
106 0.35
107 0.4
108 0.38
109 0.38
110 0.42
111 0.46
112 0.45
113 0.49
114 0.5
115 0.45
116 0.46
117 0.45
118 0.47
119 0.46
120 0.51
121 0.48
122 0.52
123 0.52
124 0.52
125 0.5
126 0.46
127 0.43
128 0.41
129 0.43
130 0.34
131 0.35
132 0.34
133 0.37
134 0.32
135 0.31
136 0.3
137 0.27
138 0.31