Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UV61

Protein Details
Accession E4UV61    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-115IYIKLPSRWSRTQKKKRRRSNKLLANWIFKGHydrophilic
NLS Segment(s)
PositionSequence
14-22KKGKGRGRG
76-106GPGRGRREGIYIKLPSRWSRTQKKKRRRSNK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKLVEEEEEEKEEKKGKGRGRGRIYDNPKVGEEVRSYDEGQKTQQVKKRQASRGRIFGCKTLPRAAGVRSSYYIRGPGRGRREGIYIKLPSRWSRTQKKKRRRSNKLLANWIFKGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.4
4 0.49
5 0.56
6 0.63
7 0.66
8 0.72
9 0.72
10 0.74
11 0.75
12 0.73
13 0.69
14 0.61
15 0.53
16 0.48
17 0.42
18 0.35
19 0.28
20 0.23
21 0.22
22 0.22
23 0.23
24 0.25
25 0.26
26 0.24
27 0.24
28 0.28
29 0.29
30 0.33
31 0.38
32 0.42
33 0.48
34 0.54
35 0.62
36 0.64
37 0.69
38 0.72
39 0.71
40 0.72
41 0.67
42 0.64
43 0.55
44 0.49
45 0.45
46 0.38
47 0.35
48 0.29
49 0.26
50 0.23
51 0.24
52 0.22
53 0.23
54 0.21
55 0.2
56 0.18
57 0.2
58 0.19
59 0.18
60 0.23
61 0.18
62 0.23
63 0.25
64 0.3
65 0.36
66 0.39
67 0.41
68 0.37
69 0.42
70 0.39
71 0.39
72 0.4
73 0.37
74 0.34
75 0.36
76 0.38
77 0.38
78 0.42
79 0.47
80 0.49
81 0.56
82 0.66
83 0.73
84 0.8
85 0.86
86 0.9
87 0.92
88 0.94
89 0.94
90 0.94
91 0.94
92 0.94
93 0.92
94 0.93
95 0.88
96 0.84
97 0.74