Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5QZV4

Protein Details
Accession E5QZV4    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGSIRRSKTKRRTRDYDQVVADHydrophilic
61-80NLVAHRKGKNHKRRLRMLLHBasic
NLS Segment(s)
PositionSequence
66-74RKGKNHKRR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGSIRRSKTKRRTRDYDQVVADLRSRKHLTQYHNTKDVEDLPGLGKHYCVECAKWFESDYNLVAHRKGKNHKRRLRMLLHEPHTQKTAEAAIGLGVDNGPRTTDSNTAMEIETEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.82
4 0.73
5 0.66
6 0.59
7 0.51
8 0.46
9 0.4
10 0.33
11 0.32
12 0.33
13 0.3
14 0.36
15 0.41
16 0.44
17 0.5
18 0.59
19 0.59
20 0.62
21 0.61
22 0.53
23 0.49
24 0.44
25 0.35
26 0.25
27 0.19
28 0.14
29 0.15
30 0.15
31 0.13
32 0.11
33 0.1
34 0.1
35 0.12
36 0.11
37 0.12
38 0.13
39 0.18
40 0.19
41 0.19
42 0.19
43 0.16
44 0.17
45 0.17
46 0.15
47 0.12
48 0.13
49 0.12
50 0.13
51 0.17
52 0.19
53 0.24
54 0.33
55 0.42
56 0.51
57 0.61
58 0.68
59 0.72
60 0.78
61 0.8
62 0.79
63 0.76
64 0.75
65 0.74
66 0.71
67 0.7
68 0.63
69 0.56
70 0.5
71 0.42
72 0.33
73 0.25
74 0.22
75 0.15
76 0.13
77 0.1
78 0.09
79 0.09
80 0.09
81 0.07
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.08
88 0.1
89 0.13
90 0.17
91 0.2
92 0.21
93 0.22
94 0.23
95 0.22